KEGG   Methylobacterium sp. 17Sr1-43: DK427_03275Help
Entry
DK427_03275       CDS       T05919                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_03275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_03275
Two-component system [BR:meti02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DK427_03275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AWN34882
UniProt: A0A2U8VNA7
Position
complement(746263..746970)
Genome map
AA seq 235 aa AA seqDB search
MGAARAELPESAPHVLVVDDDRRLRELLSRYLADQGFRVTSAASAAEARAKAQSLLFDAM
VLDVMMPGENGFDYARSVRETSRVPILMLTARSNTNDRVMGLEIGADDYLPKPFEPRELT
LRLSNIINRSQAARPANGTEPVTFGPFVFRPDRGELRRGEEVIRITERERELLTILAAAA
GGNVEREQLSGGVGAVAERAVDVQINRLRRKIEVDPANPLLLQTVRGVGYRLAVD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgcgcgcgccgagctgcccgaatccgccccgcacgtgctcgtcgtcgacgac
gaccggcgcctgcgcgagcttctctcccgctatcttgccgaccagggttttcgcgtgacg
agcgcggcgagcgcggccgaggcccgggccaaggcccagagcctgctgttcgacgcgatg
gtgctcgacgtgatgatgccgggcgagaacggcttcgactacgcccgcagcgtgcgcgag
acctcgcgggtcccgatcctgatgctgaccgcccgctccaacaccaacgaccgggtcatg
gggctggagatcggcgccgacgactacctgccgaagcccttcgagccgcgcgagctgacg
ctgcgactgagcaacatcatcaaccgctcgcaggcggcgcgccccgcgaacggcaccgag
cccgtgaccttcggccccttcgtcttccggcccgaccggggcgagctgcggcgcggcgag
gaggtgatccgcatcaccgagcgcgagcgggaactcctgacgatcctggccgcggcggcc
ggcggcaacgtcgagcgcgagcagctctccggcggcgtgggcgccgtggccgagcgggcg
gtcgacgtgcagatcaaccgcctgcgccggaagatcgaggtcgatccggccaaccccctg
ctgctgcagacggtgcggggcgtcggctacaggctggccgtcgattag

DBGET integrated database retrieval system