KEGG   Methylobacterium sp. 17Sr1-43: DK427_17635Help
Entry
DK427_17635       CDS       T05919                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00450  Selenocompound metabolism
meti00970  Aminoacyl-tRNA biosynthesis
meti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DK427_17635
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DK427_17635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:meti01007]
    DK427_17635
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:meti03016]
    DK427_17635
Enzymes [BR:meti01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DK427_17635
Amino acid related enzymes [BR:meti01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DK427_17635
Transfer RNA biogenesis [BR:meti03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DK427_17635
 Prokaryotic type
   Other AARSs
    DK427_17635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AWN37325
UniProt: A0A2U8VUE6
Position
3776378..3777937
Genome map
AA seq 519 aa AA seqDB search
MTDSKTFSISTAISYPNGAPHIGHAYEVIATDAIARFKRLDGYDVLFSTGTDEHGLKIQQ
AATKAGIAPRQYVEGTAAPFRAMADRLDCAYDRFIRTTEAEHYAAAQELWRRMEVNGDIY
LAKYAGWYSVRDEAYYDEDETVLQADGSRRSAKTDTPVEWMEEENFLFRLSAYQDRLLKL
YADRPDFLGPDTRMNEVASFVRGGLNDLSISRTTFDWGVPVPGHPGHVMYVWVDALTNYL
TVTGFPDAQDPRKKYWPMDLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFLLSKG
EKMSKSLGNVVDPLDLAETYGVDPVRYFVLREVPFGGDGNYSHDGIINRINADLANDLGN
LAQRSLSMVAKNCGAAVPEPGALTEADRALLDAAGALPEKARAAMDVPAPHTALAEIWAV
VADANRYFAGEEPWKLRKSDPARMNTVLYVTLETLRRVGLLVQPFVPSAAAKLLDLLAVP
ADRRMLEDAGEGGDLVPGTALPAPAPIFPRFEKPEAPAA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatagcaagaccttcagcatctcgacggcgatctcctacccgaacggcgcgccg
catatcggccacgcctacgaggtgatcgccaccgacgccatcgcgcgcttcaagcggctg
gacggctacgacgtgctgttctccaccggcaccgacgagcacgggctgaagatccagcag
gccgcgacgaaggccgggatcgccccccgccagtacgtcgagggcaccgccgccccgttc
cgcgcgatggccgaccggctcgactgcgcctacgaccgcttcatccgcaccacggaggcc
gagcactacgccgccgcccaggaactctggcgccgcatggaggtcaacggcgacatctac
ctcgccaagtatgccggctggtactcggtccgcgacgaggcctattacgacgaggacgag
acggtgctgcaggcggatggcagccgccgctccgccaagacagacacgccggtcgagtgg
atggaggaggagaacttcctgttccgcctctcggcctatcaggatcggctcttgaagctc
tacgccgatcggcccgatttcctcgggcccgacacccggatgaacgaggtggcgagcttc
gtgcggggcggcctcaacgacctctcgatcagccgcaccaccttcgactggggcgtgccg
gtgccgggccatccgggccacgtcatgtatgtctgggtcgacgccctgacgaactatctc
acggtcacgggcttccccgacgcgcaggacccgcggaagaagtactggccgatggacctg
cacatcatcggcaaggacatcgtgcgcttccacgcggtgtactggccggccttcctgatg
tcggccgggttgccgctgccgaagcgcgtgttcggccacggcttcctgctctcgaagggc
gagaagatgtcgaagtcgctcggcaacgtggtcgacccgctcgacctcgccgagacctac
ggggtcgatccggtgcgctacttcgtgctgcgcgaggtgcccttcggcggcgacggcaac
tacagccacgacggcatcatcaaccgcatcaacgcggaccttgcgaacgacctcggcaac
ctcgcccagcgctcgctctcgatggtggcgaagaactgcggggccgcggtgccggagccc
ggtgccctcacggaggccgaccgcgccctgctcgacgccgcaggagcgctccccgagaag
gcccgcgccgccatggacgtgccggcgccccacacggcgctcgccgagatctgggccgtt
gtggcggacgccaaccgctacttcgcgggcgaggagccgtggaagctccgcaagagcgac
cccgcccggatgaacaccgtcctgtacgtgacgctggagacgctgcggcgggtcggcctg
ctggtgcagcccttcgtgccttccgcggcggccaagctcctcgacctgctggcggttccg
gccgaccggcgcatgctcgaggatgcgggggagggcggtgatctcgtccccggcacggcc
ctgcccgcgcccgccccgatattcccgcgcttcgagaagccggaagcgcccgccgcctga

DBGET integrated database retrieval system