KEGG   Methylobacterium sp. 17Sr1-43: DK427_18800Help
Entry
DK427_18800       CDS       T05919                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti03010  Ribosome
Brite
KEGG Orthology (KO) [BR:meti00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DK427_18800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:meti03011]
    DK427_18800
Ribosome [BR:meti03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DK427_18800
  Bacteria
    DK427_18800
  Archaea
    DK427_18800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF3734
Motif
Other DBs
NCBI-ProteinID: AWN37522
UniProt: A0A2U8VWD8
Position
complement(4000774..4001157)
Genome map
AA seq 127 aa AA seqDB search
MGKQATPRALPENEAKAVARMIRVSPQKLNLVAQLIRGKKVESALADLQFSRKRIATDVK
KCLESAIANAENNHNLDVDDLIVSEAYVGKALVLKRFHARARGRGARILKPFSNLTIVVR
EVRAEAA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcaggccaccccccgcgcgctccccgagaacgaggcgaaggcggtcgcgcgg
atgatccgcgtctccccgcagaagctcaacctcgtggcgcagctgatccgcggcaagaag
gtggagtcggcgctggccgacctccagttctcgcgcaagcgcatcgcgaccgacgtcaag
aagtgcctcgagagcgccatcgccaacgccgagaacaaccacaacctcgacgtggacgac
ctgatcgtctccgaggcctatgtgggcaaggcgctggttctcaagcgcttccacgcccgc
gcccgcggccgcggcgcgcgcatcctgaagcccttctcgaacctcaccatcgtggttcgg
gaagtccgggccgaagcggcctga

DBGET integrated database retrieval system