KEGG   Methylobacterium sp. 17Sr1-43: DK427_22075Help
Entry
DK427_22075       CDS       T05919                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00220  Arginine biosynthesis
meti00330  Arginine and proline metabolism
meti01100  Metabolic pathways
meti01110  Biosynthesis of secondary metabolites
meti01130  Biosynthesis of antibiotics
meti01230  Biosynthesis of amino acids
Module
meti_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    DK427_22075 (rocF)
   00330 Arginine and proline metabolism
    DK427_22075 (rocF)
Enzymes [BR:meti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DK427_22075 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AWN39164
UniProt: A0A2U8VZC4
Position
4698131..4699087
Genome map
AA seq 318 aa AA seqDB search
MPDGGAAGRRIVVIGAPIEVGTSEPGALMGPAALRTAGLILSLRDLGHEVVDAGDVAPGL
VPEARGLPAVAAWTRALARAVETALDAGGLPLVMGGDHSLSLGSVEGAMRHCAAAGRALS
VLWLDAHADFNTPETSPSGNIHGMPLAALCGEPGFSGLFEDADRASLDPARVHLFGLRSI
DAGERALVRARRLGVIDMRDIDEFGVVAPLRRILDRVAEAGDHLHVSFDVDFLDPALAPG
VGTTVPGGATFREAHLIMEMLHDSGLVRSLDVVELNPFLDERGRSARVLVELVASLFGRR
ILDRPTPPIEALPGRGPA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgacggcggcgcggcggggcgcaggatcgtcgtgatcggagcgccgatcgaggtc
ggcaccagcgagcccggagccctgatgggaccggcggccctgcgcacggccggcctgatc
ctcagcctgcgcgatctcggccacgaggtcgtcgacgcgggcgacgtggcgccgggcctc
gtcccggaggcgcgcggcctgcccgccgtcgccgcctggacccgagccctggcaagggcg
gtggagacggcgctcgatgcgggcggcctgccgctggtgatgggcggagaccacagcctg
tccctgggttccgtcgagggggcgatgcgccattgcgcggccgcggggcgggccctctcc
gtgctctggctcgacgcgcacgccgacttcaacacgcccgagacctcgccctcgggcaac
atccacggcatgccgctcgccgcgctctgcggcgagccgggcttttccgggctgttcgag
gatgccgatcgggcgagcctcgaccccgcgcgggtccacctgttcggtttgcgctcgatc
gatgcgggcgagcgcgcgctggtccgcgcgcgccggctgggcgtgatcgacatgcgcgac
atcgacgagttcggcgtggtggccccgctccggcgcatcctcgaccgcgtggcggaggcg
ggcgaccatctgcacgtcagcttcgacgtcgatttcctggaccccgcgctcgcgccgggc
gtcggcaccacggtgccgggcggtgcgacctttcgggaggcgcatctgatcatggagatg
ctgcacgattccgggctggtccgctccctcgacgtggtcgagctgaacccgttcctcgac
gagcgcggccgcagcgcccgcgtgctggtggagctggtcgcgagcctgttcggccgacgc
atcctcgaccgcccgacgccgccgatcgaggcccttcccggacgcggcccggcatga

DBGET integrated database retrieval system