KEGG   Methylomonas sp. LW13: U737_06170Help
Entry
U737_06170        CDS       T05879                                 

Definition
(GenBank) SDR family NAD(P)-dependent oxidoreductase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
metl  Methylomonas sp. LW13
Pathway
metl00030  Pentose phosphate pathway
metl01100  Metabolic pathways
metl01120  Microbial metabolism in diverse environments
metl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:metl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U737_06170
Enzymes [BR:metl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     U737_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-ProteinID: QBC26534
Position
1372690..1373541
Genome map
AA seq 283 aa AA seqDB search
MGRHVVGLLLARAGRTVARCLDKPLLVPSECWRSQVGIKTGECVNVPNGGAPLSGQTALV
VRGDCGIGAVVAEAYAAAGAKVLINYLHESAAADRIAQRIRVKQGQAMIFQADLSRESQV
NSMFDVLAVYWGGLNTLVTNADLALAMPTGGIDPEQWREILRQNLVEQFLCVRQALKEFA
GRGGQTAIALAPTKIICVSTFLGGPGDNAQPYYAVCKADMAGLCKAWVSARGQENADSPV
GPLTAKRLTEIWNGQSAPDSIALVSPDPEQIAKTAVGLAVRAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtcatgttgttggtttgttgcttgcaagggccgggcggactgtcgctcgatgt
ctggataagccgctacttgttcccagtgaatgttggcgcagtcaggtcggcattaaaacg
ggagaatgcgtgaacgtcccgaacggcggagcgccgctatcggggcaaaccgcgttggtg
gttcgcggcgattgtggtatcggcgcggtggtggcggaggcgtatgccgctgccggtgcc
aaggtgttgatcaattatctgcacgaaagcgcggcagcggaccgcattgcccagcggatt
cgggttaagcagggacaagccatgatatttcaagccgatcttagccgggaaagccaagtt
aacagtatgttcgatgtactcgccgtctattggggcggcttgaatacattagtgacgaat
gccgatctggcgcttgctatgccgactggtggtatagatccggagcaatggcgggaaatt
ttgcggcaaaatctggtcgagcaatttttatgcgtcagacaggcgctgaaagagtttgcc
ggacgcggcgggcaaacggctatagcattggcaccgaccaaaatcatctgcgtatccact
ttcctgggcggcccaggcgataacgcgcaaccctactatgcagtctgtaaggccgacatg
gccggattatgcaaggcttgggttagtgcgcgtggtcaagaaaatgcggacagccctgtc
ggtccactcactgcaaaacgcttgactgaaatttggaacggtcagtcggcgccggactcg
atagcgctggtgtcacccgatccagagcaaatagcaaaaaccgccgtcggcttggctgta
cgcgcagcttaa

DBGET integrated database retrieval system