KEGG   Methylomonas sp. LW13: U737_07795Help
Entry
U737_07795        CDS       T05879                                 

Gene name
putA
Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
metl  Methylomonas sp. LW13
Pathway
metl00250  Alanine, aspartate and glutamate metabolism
metl00330  Arginine and proline metabolism
metl01100  Metabolic pathways
metl01110  Biosynthesis of secondary metabolites
metl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:metl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U737_07795 (putA)
   00330 Arginine and proline metabolism
    U737_07795 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:metl03000]
    U737_07795 (putA)
Enzymes [BR:metl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     U737_07795 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     U737_07795 (putA)
Transcription factors [BR:metl03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    U737_07795 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: QBC26812
Position
complement(1711188..1714268)
Genome map
AA seq 1026 aa AA seqDB search
MSNANRLAELRRRINQAFTQAEPRAISGLIARLGDYDSQAIGASTQALIEAVRAKHKQPG
IFEAFLHEYSLSSDEGIVLMSIAEALLRIPDSDTQNLFLRDKLADADWYSHWLHSESVAV
NLASGGLWISGKMEELVRQRVFDGLLSRLGEPLIRAAIKQAMQQMAEHFVIAENINAAIK
QSDRNPAYHYSFDMLGEAALTQDDAERYCAAYRHAIETLAESATADLFTNPGISIKLSAL
YPRYEPLQQRYAVPAISDKLLALVKLARAANISVTVDAEEAERLDMSLDIFAAVFDDPAL
AAWPGFGLAVQAYQKRALAVIDWLAALAESQKRIIPIRLVKGAYWDSEIKRAQENGWDDY
PVFTRKPATDLSYLTCARLILSKPQAFYPQFATHNAHSVAAICEFGKEHPGFEFQRLHGM
GSALYDELLNQRPINCRVYAPVGSYRDLLPYLVRRLLENGANTSFINQIENPAISSAMLS
GDPLNQLNEVETNPLTVPTDLFGAQRKNSQGLNLSDPEKLQQLQNELAAMSDQTWQAAPL
IAGQQMHGEPHPVYSPHDQLSLVGEVVFSSANDIEQALQQATRAFDDWRLCPVATRTGYL
LKAADLLEQQRLKLVALCIREGGRTVRDALAEVREAVDLCRYYAACAVEQFAQPLRLPGP
TGEDNQLFSVGRGVFVCISPWNFPIAIFIGQIAAALVAGNTVIAKPALQTSLTATACLRL
LHSAGVPEQVLQFLPGEGAEIGRHLLSDERVAGVAFTGSVATALNINRQLASRNGAIATL
IAETGGQNAMIADSSAHQEQLVTDALQSAFNSAGQRCSALRVLFLPDDIADSVIARLIGA
MRVLRVGSPLDIATDVGPIIDQRALAALQQHIEKLEHDAKLLYQLPLTDDLTNGCFFPPT
LAEIPALSFLDHEVFGPILHIVRYPANELAKVVEAINASGYGLTLGIHSRINANMRYIQE
HARVGNIYINRNMIGAVVGVQPFGGMGLSGTGPKAGGPHYLQRFANEQTLTTNLTAIGGN
PWLLRK
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgccaaccgtttagccgaactgcgccggcgcatcaatcaagcatttacccaa
gcagagccgcgagccatctccggcctaatcgccaggttgggagattacgatagccaggcc
atcggcgcctctacgcaggcattaatagaagcggtacgcgccaagcataaacagccgggc
attttcgaagccttcttgcacgaatacagcctgagcagcgatgaaggcatcgtcttgatg
agcatcgccgaagcgctgctgcggattccggatagcgacacgcaaaacctgttcttgcgc
gataaactcgccgatgccgactggtatagccactggttgcacagcgagtcggtagcagtc
aatctggctagtggcggtttatggatcagcggcaaaatggaagaactggttcggcagcgg
gttttcgatggattattaagccggctgggcgagccgctgatccgcgcagcgatcaagcaa
gccatgcagcaaatggccgaacatttcgtcatcgccgaaaacataaacgcggctatcaaa
caatccgaccgcaatccggcctatcactattctttcgatatgctcggcgaagcggcctta
acccaagacgatgcggaacgctattgcgcggcctatcggcatgccattgaaacgctggcc
gaatcagcaacagccgatttatttaccaaccccggcatttccatcaagctgtcggcgtta
tatccgcgttatgagccattacagcagcgttatgcggtgccggccatcagcgacaaactg
ttagctttggttaagctggcccgcgcggcgaatatttccgtgactgtcgacgcggaagaa
gccgaacggctggatatgtctttggatattttcgcggcggtatttgacgatccggcgctg
gccgcttggccgggcttcggtctggcagtgcaagcttatcaaaaacgcgcgttggcggtg
atcgattggctggcggcattggccgaatcccagaagcgcatcattcccattcgcttggta
aaaggcgcgtactgggatagcgagatcaaacgcgcccaggaaaacggctgggacgactac
ccggtgttcacccgaaagcctgccaccgacttgtcttatctgacttgcgctcggctgata
ctgtccaagcctcaagctttttatccgcaatttgccacgcataatgcccacagcgtcgcg
gcgatttgcgagtttggcaaagagcatccggggtttgagttccagcgactgcatggcatg
gggagcgctttgtatgatgaattgctcaatcaacgcccgatcaattgccgcgtctatgcg
ccggtcggcagctaccgggatttgttgccttatttggtcagacgcttgctggagaacggt
gcgaatacctcgtttatcaatcaaatcgaaaatccggcgattagctctgccatgctgtcc
ggcgatcctttgaaccagttaaacgaagtcgagactaaccctcttactgttcccactgac
ttattcggcgcgcaacgcaagaactcgcaggggctgaatttaagcgatcccgagaaatta
cagcagttgcaaaatgaattggctgctatgtcggaccagacttggcaagccgcaccattg
attgctggtcaacaaatgcatggcgaaccgcatccggtttatagtccgcacgaccagctc
agcctggttggcgaagtggtgttcagttccgcaaatgatatagaacaagccttgcaacaa
gccacacgcgcgttcgatgactggcgtttatgcccggtcgcaacccgcaccgggtatctg
ctaaaagcggcagatttattggagcagcagcgcctgaaattggtggcgctgtgcattcgc
gaaggtggccgaaccgtgcgcgacgcgctggcggaagtgcgggaagctgtcgatctatgc
cggtattacgcggcctgcgcggtcgaacaatttgctcagccactgcgcttaccgggtcca
accggtgaagacaatcaattatttagtgtcgggcgcggcgtgtttgtctgcatcagtccg
tggaattttccgattgcgattttcatcggccaaatcgccgccgcgttggtggccggcaat
acggtaatcgcgaaaccggcgctacaaacatcattaacggccacggcctgtttgcgcctg
ttacatagcgccggcgtcccggaacaggtactgcagtttttgccgggcgagggcgccgag
attggccgtcatttgctgagcgacgagcgcgtcgccggcgtggcgtttaccggctccgtc
gccaccgccctgaatatcaaccggcaactggcgagtcgtaacggcgccatcgccacgctt
attgccgaaaccggcgggcaaaacgcgatgatcgccgacagctccgcgcaccaggaacag
ctggtgacggacgccttgcaatcagcatttaacagcgcgggccaacgctgctcggcattg
cgggtattgtttctaccggacgacatcgccgacagcgtcattgcgcgcttgatcggcgcg
atgcgtgtgctgcgggtcggttcgccgctggatattgccaccgacgtcggccctattatc
gatcaacgcgcgttagccgccctgcaacagcacatcgagaagcttgaacacgacgccaag
ctgttatatcaactgcccttgaccgacgatctaacaaacggctgtttttttccaccgacg
ttagcggaaatacctgccctatccttccttgaccacgaagtgttcggccccatcctgcat
atagtccgttacccagccaacgagctggcaaaagtggtcgaggccatcaatgccagcggc
tacggcttgacactgggcattcacagccgcatcaacgccaatatgcgttacatccaagag
cacgcgcgggtcggcaacatttacatcaaccgcaacatgataggcgcggtggtgggtgtg
cagccgttcggcggcatgggcctgtccggcaccggcccgaaagccggcggcccccattac
ttgcaacgctttgccaacgaacaaaccctgaccaccaacctcaccgctatcggcggcaat
ccttggttgttgcgaaaataa

DBGET integrated database retrieval system