KEGG   Methylomonas sp. LW13: U737_12140Help
Entry
U737_12140        CDS       T05879                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
metl  Methylomonas sp. LW13
Pathway
metl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    U737_12140
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    U737_12140
Enzymes [BR:metl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     U737_12140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: QBC27592
Position
complement(2698146..2699537)
Genome map
AA seq 463 aa AA seqDB search
MSEHTNAFQSLFSESAGREPIEIWLTTADQQALLQPQTSGFGFNNPLGDVPVIAVDTGDV
YQTVEAFGFSLTGGSAMLIAALPNVERQALLQELFLPDGDGIGVSCLRLSIGASDLSERC
FSYDDMPDGQTDMELAHFDLNAGDIEVIPLLQDILALNPTIRIIATAWSAPRWMKTNQAF
IGGKLKPECYAVYAAYLVKYLQAMRERGIVIHGITPQNEPLNQKNEPSMAMEAPEQAAFI
KHHLGPALREAGLADVEVFCWDHNCDVKEYPLTVFADADARQYLSGSAWHLYGGDISVLS
EVHQAYPDMKLYFTEQWVGSDGEFGGDLMWHARHVLIGSLRHWSRAVLEWNLASDPFCGP
HTPGGEARCVGALTIDGDQVTRNVAYYVIAHAAKFVRPGSVRIASGVQNDYLPNVAFRTP
AGFIVLIVLNDAVEPQAFAIHYQGKNALVEIPGRAVATYVWAA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcataccaacgcttttcaatcactattttccgaaagcgcggggcgcgagcct
atagagatttggctgacgactgccgaccagcaagccttgttacaaccacagaccagtggt
tttggttttaacaaccctctcggcgatgtgccggtaatagcggtcgataccggcgatgtt
tatcaaaccgtggaagcttttggcttctccttgaccggcggcagcgccatgctgattgcg
gcactgcccaacgtcgaacggcaagctttgttgcaggaactatttttgccagatggtgac
gggatcggcgtcagctgtttgcggcttagtatcggcgcttccgatttaagcgagcgttgc
tttagctatgacgacatgcccgatggtcagactgacatggaactggcgcattttgatttg
aatgccggcgatatcgaggttattccgctactccaagatattctggcgctcaatccaact
attcgaattatcgccaccgcgtggtcggcaccgcgttggatgaagactaaccaagcgttt
atcggcggcaaacttaagcccgaatgctatgccgtctacgcggcgtatttggtgaaatat
ctgcaagcgatgcgcgaacgcggcatcgtgattcatggtatcacgccgcagaacgagccg
ctcaatcaaaaaaacgagcccagcatggcgatggaagcgccggagcaggctgcatttatc
aaacatcatttgggaccggccttgcgcgaggcgggattagctgatgtggaagtgttttgc
tgggatcacaattgcgatgtcaaagagtacccgttgacggtcttcgccgacgccgacgct
cgccagtatctcagcggctccgcttggcatctgtatggcggtgatatttcggtattatcg
gaagtgcatcaagcttaccccgacatgaaactgtatttcaccgaacaatgggtgggttcg
gacggcgagtttggtggcgatttaatgtggcacgcccgccacgtgttgatcggttcgttg
cggcactggagcagggcggtgttggaatggaatttggcctccgatccgttttgcgggccg
cacacgccgggcggcgaagcccgctgcgtgggcgcgttgacaatagacggcgatcaggtc
actcgcaatgtcgcgtattacgtgattgcccacgcggccaagtttgtccggcccggttcc
gtgcggattgcttccggcgtgcaaaacgactatttgcctaacgtggccttccgcacgccg
gcgggttttatcgtattgatcgtgttaaacgacgcagtcgagcctcaagcctttgctatc
cactatcaaggcaaaaacgcgcttgttgagataccgggcagagcagtggctacctatgtg
tgggcagcctag

DBGET integrated database retrieval system