KEGG   Methanosarcina sp. MTP4: MSMTP_3024Help
Entry
MSMTP_3024        CDS       T03850                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit H
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
metm  Methanosarcina sp. MTP4
Pathway
metm00680  Methane metabolism
metm01100  Metabolic pathways
metm01120  Microbial metabolism in diverse environments
metm01200  Carbon metabolism
Module
metm_M00357  Methanogenesis, acetate => methane
metm_M00567  Methanogenesis, CO2 => methane
metm_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:metm00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSMTP_3024
Enzymes [BR:metm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSMTP_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH LPD23
Motif
Other DBs
NCBI-ProteinID: AKB26493
UniProt: A0A0E3P022
Position
3936946..3937893
Genome map
AA seq 315 aa AA seqDB search
MFKFDKKQEVFEIGGVKFGGQPGEYPTVLVSTMFYARHKIVTDEDKGLFDVAAAETLWNT
QVELSDATGNPYVNQIVGETPESIRKYIDWFIGIDDKTPFLIDSSAGEVRAAAAQYCTEI
GVADRAIHNSINASIEQDEIDVLTESDVEAAIVLAFNATDPTVKGKLDILEVGGSGQDKG
MLQIAKECGITSPLIDVAAMPLGAGSGATIRSVPTIKGKLGLPVGGGYHNMASAWDWLRK
FKKTQPDPKSIYMPSDIGTNLVAQIAGSDYLLYGPIENVEKVFPAVAMVDIMLGETAKEL
DVEIAVENHPVNQLT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtttgacaagaaacaggaagtattcgaaattggcggagtcaagttcggcggg
cagccgggtgagtacccgaccgtgttagtcagtaccatgttctacgcaaggcacaagatt
gtgaccgacgaggacaagggactattcgacgtagcagcagcagaaaccctgtggaacacc
caggtagaactgagtgacgctacaggaaacccctacgtgaaccagattgtgggagaaacc
cctgaatctatcaggaagtacatcgattggttcatcggaatcgatgacaagacccccttc
ctgatcgactcttcagcaggagaagttcgtgcagccgctgcccagtactgtaccgaaatc
ggtgtagctgacagggcaatccacaactccatcaacgccagtatcgaacaggacgaaatt
gacgttctcacggagagcgatgtggaagctgccatcgtgctggccttcaacgcaaccgac
ccgaccgtcaaaggtaaactcgacatccttgaagtcggtggttccggacaggacaagggt
atgctccagatagccaaggaatgtgggatcacgtcccccctgatcgacgtagcagcaatg
cctctcggtgcaggctcaggcgcaacaatccgctcagtcccgaccatcaagggtaagctc
ggcctgcctgtaggcggtggataccacaacatggcatccgcatgggactggctcaggaag
ttcaagaagactcagcctgacccgaagtcaatctacatgccctctgacatcgggaccaac
ctggtagcccagatcgcaggttctgactacctcctctacggtccgatcgagaatgtcgaa
aaggtcttcccggctgtcgcaatggtcgacatcatgctcggagaaaccgcaaaagaactc
gacgtcgagatcgctgtggagaaccacccggtcaaccagctaacataa

DBGET integrated database retrieval system