KEGG   Methanobacterium sp. MZ-A1: BK008_01665Help
Entry
BK008_01665       CDS       T05317                                 

Definition
(GenBank) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
metn  Methanobacterium sp. MZ-A1
Pathway
metn00790  Folate biosynthesis
metn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BK008_01665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:metn04147]
    BK008_01665
Enzymes [BR:metn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BK008_01665
Exosome [BR:metn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BK008_01665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AUB57156
UniProt: A0A2H4VGE3
Position
328730..329023
Genome map
AA seq 97 aa AA seqDB search
MSLPQLLSQKEIEQNSSQLDNWSVLENRYLVSVFEFPDFVNALEFTVKVGLVAEEMQHHP
EINLSWGKVALEITTDDMGGLTELDFLFALKVNKLFE
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgtccctacctcaacttttaagtcaaaaagaaattgaacagaattcatcccagcttgat
aactggtctgttcttgaaaaccgttatctggtatctgtttttgaatttccggactttgta
aatgcccttgaattcacagttaaggttggtttagtagcggaagagatgcaacaccatccc
gaaatcaatttatcatggggtaaggtagccctggaaataaccactgatgacatgggcgga
ttaaccgaattggacttcttatttgccctgaaagttaataaattgtttgaatga

DBGET integrated database retrieval system