KEGG   Methanobacterium sp. MZ-A1: BK008_11740Help
Entry
BK008_11740       CDS       T05317                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
metn  Methanobacterium sp. MZ-A1
Pathway
metn00760  Nicotinate and nicotinamide metabolism
metn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BK008_11740
Enzymes [BR:metn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BK008_11740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AUB58919
UniProt: A0A2H4VLF2
Position
complement(2421368..2421892)
Genome map
AA seq 174 aa AA seqDB search
MRGLLVGRMQPVHRGHIQVMERILNDVEEVIIGIGSAQVSHSLKDPFTAGERVMMITKAL
AENDIPASCYYIIPVQDIECNSLWVAHMEMLTPPFEHVYSGNPLVQRLFHEKGYQVTEPP
LFNRKSYSGTEVRRRMLAGDNWEKLVPESVVEVINEIDGIARIKQLARKEVSEV
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagaggacttctggtggggagaatgcaaccggtgcaccggggacatattcaggtaatg
gaaaggatcctgaatgatgtggaagaagtgatcattggaattggtagtgcgcaggtcagt
cacagtcttaaagatccattcaccgccggagagagggtgatgatgatcactaaggccctg
gcagaaaatgacataccagcatcctgttactacatcataccagtgcaggatatagagtgt
aactccctctgggtggcccatatggaaatgttaaccccaccatttgaacatgtctactct
ggcaacccactggtccagagactttttcatgaaaagggttatcaggttaccgaaccccca
ttatttaacagaaaaagctattccgggacagaagttcggcgtagaatgctagctggtgat
aactgggaaaaattagtcccagaatcagtagtagaagttattaatgaaattgatggtatt
gctagaattaaacaactagccagaaaggaggtaagtgaagtatga

DBGET integrated database retrieval system