KEGG   Methylibium sp. Pch-M: C1M51_01050Help
Entry
C1M51_01050       CDS       T05827                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system aminomethyltransferase GcvT
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
metp  Methylibium sp. Pch-M
Pathway
metp00260  Glycine, serine and threonine metabolism
metp00630  Glyoxylate and dicarboxylate metabolism
metp00670  One carbon pool by folate
metp01100  Metabolic pathways
metp01110  Biosynthesis of secondary metabolites
metp01130  Biosynthesis of antibiotics
metp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:metp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C1M51_01050 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C1M51_01050 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C1M51_01050 (gcvT)
Enzymes [BR:metp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     C1M51_01050 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: QAZ38122
Position
230172..231476
Genome map
AA seq 434 aa AA seqDB search
MSAPAGSPAAPLLTTPLHALHLELGARMVPFAGYDMPVNYPSGILAEHRQCRDAAALFDV
SHMGQIRLLADDPQQAALALETLVPMDVLGLGVGKQRYAFFTNAGGGLLDDLMITRREND
LLLIVNAACKDADLHHLQMHIGHRCTVQALPERALLALQGPKAATALARLNPGVSALTFM
TGGAFTLVGTDCYLTRSGYTGEDGFEISVPLQGPKAATALARLNPGVSALTFMTGGAFTL
VGTDCYLTRSGYTGEDGFEISVPATHAEALARELLAQPEVAPAGLGARDTLRLEAGLCLY
GHDIHTGTTPIEAGLSWAIQKVRRAGGARAGGYPGADVIDAQLAGGVSERRVGLLGLERV
PVREGTELVDGQGQRIGRVTSGTLGPTVNQPIAMACIASNHANVSHEVFAMVRGKKLPMC
VVALPFTPHRYVRA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacctgccggcagccctgccgcccccttgctcaccacaccgctgcacgcgctt
cacctggaactcggcgcccggatggtgcccttcgccggctacgacatgccggtcaactac
ccgagcggcatcctggccgagcaccggcagtgccgcgatgcggccgcgctgttcgatgtg
tcgcacatgggccagatccggctgcttgcggacgatccgcagcaggctgcgctcgcgctc
gagaccctggtgccgatggatgtgctcggcctcggtgtcggcaagcagcgctacgccttc
ttcaccaatgccggcggcggcctgctcgacgatctgatgatcacccggcgcgagaacgac
ctgctgctgatcgtcaacgccgcctgcaaggatgccgacctgcaccacctgcagatgcac
atcggccaccgctgcacggtgcaggccctgcccgagcgggcactgctggccctgcagggg
ccgaaggccgccacggccctggcgcgtttgaaccccggcgtgagcgccctcaccttcatg
actggcggcgccttcacgctggtcggtaccgactgctacctcacccgttccggctacacc
ggcgaggacggattcgagatctcggtgcccctgcaggggccgaaggccgccacggccctg
gcgcgtttgaaccccggcgtgagcgccctcaccttcatgactggcggcgccttcacgctg
gtcggtaccgactgctacctcacccgttccggctacaccggcgaggacggattcgagatc
tcggtgccggccacccatgccgaggcgctggcgcgcgagctgctcgcccagcccgaggtc
gcgccggccggcctgggcgcgcgcgatacgctgcgcctagaagccgggctgtgcctctac
ggccacgacatccacaccggcaccacgccgatcgaggccggcctgtcctgggcgatccag
aaagtgcggcgtgccggtggcgcgcgggcgggtggctaccccggggcggacgtcatcgac
gcccagctcgccggcggcgtgagcgagcgccgcgtcggcctgcttggcctggagcgggtg
ccggtgcgcgagggcaccgaactcgtcgacggccagggccagcgcatcggccgggtgacc
agcggcaccctcggtccgaccgtcaaccagccgatcgcgatggcctgcatcgccagcaac
cacgccaacgtctcgcacgaggtgttcgccatggtgcgcgggaagaagctgcccatgtgc
gtggtcgccctgcccttcacgccgcaccgctacgtgcgtgcctga

DBGET integrated database retrieval system