KEGG   Methylibium sp. Pch-M: C1M51_04810Help
Entry
C1M51_04810       CDS       T05827                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
metp  Methylibium sp. Pch-M
Pathway
metp00460  Cyanoamino acid metabolism
metp00480  Glutathione metabolism
metp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    C1M51_04810 (ggt)
   00460 Cyanoamino acid metabolism
    C1M51_04810 (ggt)
   00480 Glutathione metabolism
    C1M51_04810 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:metp01002]
    C1M51_04810 (ggt)
Enzymes [BR:metp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     C1M51_04810 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     C1M51_04810 (ggt)
Peptidases and inhibitors [BR:metp01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   C1M51_04810 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: QAZ38805
UniProt: A0A4P6GT90
Position
complement(1028325..1030052)
Genome map
AA seq 575 aa AA seqDB search
MHAAAQCLRSLFAAAVVLTAMAVQAASVAPVAAENGMVVTAHRLATQVGVDVLRRGGNAV
DAAVAVGYALAVVYPAAGNLGGGGFMTLQFADGRRTFLDFREKAPLAATADMYLGADGQP
VKGLSTRGHLAVGVPGTVSGLEFARAKYGTMQRAALVAPALRLARRGFVLEPGDIAMLAT
ATDDFRKDPASAAIFLREGAPWSAGQRLVQKDLARTLQRIARHGSRGFYQGPVGAALVAS
SRAGGGLITQADLDQYATRELAPVECDYRGYRIVSAPPPSAGGVILCELLNILEGYPLQE
LGYGAAQGVHYQIEAMRHAYVDRNSYLGDPDFVHNPLERLLDKDYAARIRAAIDPARAGV
SQDLRPGVAPHEGSNTTHYSIIDREGNAASVTYTLNDWFGARVAAAGTGVLLNNEMDDFT
IKLGAANLYGLVQGESNRIAPGKRPLSSMSPTIVSRAGQPVLVLGTPGGSRIITVTALVL
LNLIDYGMTVQEAVDAPRFHQQWQPEATNLEPFALSPDTRQILLGMGHRFGAPQPANHVA
AILVGAPSLGGKPVGKHRYYGANDPRRNTGLAAGY
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcagcagcccagtgcttgaggtccctctttgccgcggccgtggtgctgaccgcg
atggccgtgcaggcggcgtcggtcgcgccggtcgcggccgagaacggcatggtcgtcacc
gcgcaccggctggcgacgcaggtcggggtcgacgtgctgcggcgcggcggcaatgcggtc
gatgccgcggtggcggtcggctacgcgctggcggtggtctacccggcggccggcaacctg
ggcggcggcggcttcatgacgctgcagttcgccgacggccgcaggaccttcctcgacttc
cgcgagaaggcgccgctcgcggccacggccgacatgtacctcggcgccgatggccagccg
gtcaagggtctcagcacgcgcggccatctggccgtcggcgtgcccggcacggtgtccggg
ctcgagttcgcgcgtgcgaagtacggcacgatgcaacgtgcggccctcgtggcacccgcg
ctgcggctggcgcgtcgtggcttcgtgctggagccgggcgacatcgccatgctcgccacc
gcgaccgacgacttccgcaaggacccggcctcggccgcgatcttcctgcgcgagggcgcg
ccgtggtctgctggccagcggctggtgcagaaggacctggcgcgtacgctgcagcgcatc
gcccgccacggcagccgcggcttctaccagggcccggtgggtgcggcgctggtggcgtcg
agtcgggccggtggcggcctgatcacgcaggccgatctggaccagtacgcgacccgcgag
ctcgcgccggtggagtgcgactaccgcggctaccggatcgtctcggcgccgcccccgagc
gccggcggcgtgatcctgtgcgagctcctcaacatcctggagggttatccgctgcaggag
ctgggctatggcgcggcgcagggcgtgcactaccagatcgaggcgatgcgccatgcctac
gtcgaccgcaacagctacctgggcgaccccgacttcgtgcacaacccgctggagcgcctg
ctcgacaaggattacgccgcgcgcatccgggccgccatcgacccggcgcgggccggcgtg
tcgcaggacctgcgacccggcgtcgcgccgcacgagggcagcaacaccacccactactcc
atcatcgaccgcgagggcaatgcggcctcggtgacctacacgctcaacgactggttcgga
gcccgcgtcgccgcggccggcaccggcgtgctgctgaacaacgagatggacgacttcacc
atcaagctcggcgccgcgaacctgtacggcctggtgcagggcgagtcgaaccggatcgcg
cccggcaagcgtccgctcagctcgatgagcccgaccatcgtgtcgcgcgccggccagccg
gtgctggtgctgggcacgcccggcggcagccgcatcatcaccgtgacggcgctggtgctg
ctgaacctgatcgactacggcatgacggtgcaggaggcggtcgatgccccgcgcttccac
cagcagtggcagccggaggcgacgaacctcgagccgttcgcgctgagccccgacacgcgg
cagatcctgctcggcatgggtcaccgcttcggcgccccgcaaccggccaaccacgtggcg
gcgatcctggtcggtgcgccctcgctgggtggcaagccggtcggcaagcatcgctactac
ggcgccaacgatccgcgccgcaacaccgggctggcggccgggtactga

DBGET integrated database retrieval system