KEGG   Methylibium sp. Pch-M: C1M51_07205Help
Entry
C1M51_07205       CDS       T05827                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
metp  Methylibium sp. Pch-M
Brite
KEGG Orthology (KO) [BR:metp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C1M51_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: QAZ39235
UniProt: A0A4P6GUD9
Position
1521518..1521892
Genome map
AA seq 124 aa AA seqDB search
MARPEFTISVVARYLPEQSAPEQQAYAFSYSVTIVNSGDVPAQLIGRHWLITDASGARQE
VRGLGVIGQQPLLQPGEQFEYQSWARIAAPRGQMQGSYFCMSADAQAFEAAIPPFELSQH
SALH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcccgagttcacaatcagcgtcgtcgcgcgctacctgcccgagcaatcggcc
cccgagcaacaggcgtacgcgttctcgtactcggtgaccatcgtcaacagcggcgacgtg
cccgcccagctgatcggccgccactggctgatcaccgacgccagtggcgctcggcaggag
gtgcgcggcctgggcgtcatcggccagcagccgctcctgcagcccggtgagcagttcgaa
taccagagctgggcccgcatcgccgcgccgcgcggccagatgcagggcagctacttctgc
atgagcgccgacgcacaggcgttcgaggccgcgatcccgccgttcgagctgtcgcagcac
tcggcgctgcattga

DBGET integrated database retrieval system