KEGG   Methyloversatilis sp. RAC08: BSY238_1265Help
Entry
BSY238_1265       CDS       T04449                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00010  Glycolysis / Gluconeogenesis
metr00030  Pentose phosphate pathway
metr00051  Fructose and mannose metabolism
metr00680  Methane metabolism
metr01100  Metabolic pathways
metr01110  Biosynthesis of secondary metabolites
metr01120  Microbial metabolism in diverse environments
metr01130  Biosynthesis of antibiotics
metr01200  Carbon metabolism
metr01230  Biosynthesis of amino acids
Module
metr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
metr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
metr_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
metr_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:metr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSY238_1265 (fba)
   00030 Pentose phosphate pathway
    BSY238_1265 (fba)
   00051 Fructose and mannose metabolism
    BSY238_1265 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    BSY238_1265 (fba)
Enzymes [BR:metr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BSY238_1265 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase OST_P2 AP_endonuc_2 TFA2_Winged_2
Motif
Other DBs
NCBI-ProteinID: AOF81514
UniProt: A0A1B3LL04
Position
1361784..1362848
Genome map
AA seq 354 aa AA seqDB search
MPMVSMRQLLDHAAENGYGIPAFNVNNLEQVQAVMSAADEVGAPVILQASAGARKYAGEP
FIKHLIEAAIESWPHIPLVMHQDHGQSPDVCKGAIDLGFSSVMMDGSLQADGKTIASYDY
NVEVTRKVVDMAHALGVTVEGELGCLGSLETMKGDKEDGHGTEATMTMDQLLTDPEEAAD
FVKRTQLDALAIAIGTSHGAYKFTRKPTGDILAISRIKEINKRIPNTHLVMHGSSSVPQD
LLAIIRQYGGDMKETYGVPVSEIQEAIKHGVRKINIDTDIRLAMTAAIRKYMFENPSKFD
PRDYLKPAREAAKGICKQRYIEFGCEGQAGKIKAIPLVQVAQNYASGKLAQQVI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcccatggtttccatgcgccagttgctcgaccacgccgccgaaaacggctacggcatc
cccgccttcaacgtgaacaacctcgagcaggtgcaggccgtgatgagcgccgccgatgaa
gtcggcgcgcccgtcatcctgcaggccagcgcaggtgcccgcaagtatgccggcgagcct
ttcatcaagcacctgatcgaagccgccatcgaaagctggccgcacattccgctggtcatg
caccaggatcacggccagagtccggacgtgtgcaagggcgcaatcgacctcggtttcagt
tcggtcatgatggacggctcgctgcaggccgacggcaagaccattgccagctacgactac
aacgtcgaagtgacgcgcaaggtggtcgacatggcgcatgcgctcggcgtgacggtcgaa
ggcgaactgggctgcctcggctcgctggaaacgatgaagggcgacaaggaagacggccac
ggcaccgaggcgacgatgaccatggaccagctgctgaccgatccggaagaagcggccgac
ttcgtcaagcgtacccagctcgacgcgctggccatcgccatcggcaccagccacggcgcc
tacaagttcacgcgcaagcccaccggcgacatcctcgcgatcagccgcatcaaggaaatc
aacaagcgcatccccaatacccatctggtgatgcatggctcgtccagcgtgccgcaggat
ctgctggcgatcatccgccagtacggcggcgacatgaaggaaacctacggcgtgccggtg
tcggaaatccaggaggcgatcaagcacggcgtgcgcaagatcaacatcgacaccgacatc
cgcctggcgatgaccgccgccatccgcaagtacatgttcgagaacccgagcaagttcgac
ccgcgcgactacctgaagccggcgcgcgaagccgccaagggcatctgcaaacagcgctac
atcgaattcggctgcgaaggccaggccggcaagatcaaggccatcccgctggtgcaggtg
gcacagaactacgccagcggaaagctcgcccagcaggtgatctga

DBGET integrated database retrieval system