KEGG   Methyloversatilis sp. RAC08: BSY238_2420Help
Entry
BSY238_2420       CDS       T04449                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00071  Fatty acid degradation
metr00072  Synthesis and degradation of ketone bodies
metr00280  Valine, leucine and isoleucine degradation
metr00310  Lysine degradation
metr00362  Benzoate degradation
metr00380  Tryptophan metabolism
metr00620  Pyruvate metabolism
metr00630  Glyoxylate and dicarboxylate metabolism
metr00640  Propanoate metabolism
metr00650  Butanoate metabolism
metr00900  Terpenoid backbone biosynthesis
metr01100  Metabolic pathways
metr01110  Biosynthesis of secondary metabolites
metr01120  Microbial metabolism in diverse environments
metr01130  Biosynthesis of antibiotics
metr01200  Carbon metabolism
metr01212  Fatty acid metabolism
metr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:metr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY238_2420
   00630 Glyoxylate and dicarboxylate metabolism
    BSY238_2420
   00640 Propanoate metabolism
    BSY238_2420
   00650 Butanoate metabolism
    BSY238_2420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY238_2420
   00072 Synthesis and degradation of ketone bodies
    BSY238_2420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY238_2420
   00310 Lysine degradation
    BSY238_2420
   00380 Tryptophan metabolism
    BSY238_2420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY238_2420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY238_2420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY238_2420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:metr04147]
    BSY238_2420
Enzymes [BR:metr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY238_2420
Exosome [BR:metr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY238_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOF82851
UniProt: A0A1B3LPS4
Position
2584567..2585850
Genome map
AA seq 427 aa AA seqDB search
MTLPDVFVVDGARTPFLKSRNAPGPFAAADLAVAAGNALLSRQRFRPDQLDEVILGCAAP
SADEANIGRIAALRLGCGDRVPGWTVMRNCASGMQALDSGIANIQRGRADLVLAGGVDAL
SRAHLLFSDAMVRWLSQWYGAKSFGARAQLLTKLRPGMLVPVIGLLKGLTDPVIGINMGQ
TAENLAARFGISRTQMDFHAMRSHQRTAAALDAGHFDEIVPIADAGGRIHMEDDGMRRDS
SVPRLARLRPVFDRAHGHITAGNSSQVTDGAAWLLLASRRAVEEHGLTPLGRIVDTEWAG
LDPAQMGLGPVHAATPILQRHGLGLNDLDAWEINEAFAAQVIGCIEAWKSDDYCRTELGL
PGALGALDERRLNVDGGAIAIGHPVGASGARIVLHLLHVLRRQGGGRGIAAICIGGGQGG
AMLVETT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgacgttttcgtggtcgatggcgcgcgcacgcctttcctgaagtcgcgc
aacgcgcccggtccgttcgccgccgccgacctcgcggtggctgccggcaatgcgctgctg
tcgcgccaacgcttccggccggatcagctcgacgaagtcatcctcggctgcgcagcgccc
tcggccgacgaagcgaacatcggacgcattgccgcgctgcgcctgggctgcggtgatcgc
gtgccaggctggacggtgatgcgcaactgcgccagcggcatgcaggcactcgattcgggc
atcgccaacatccagcgtgggcgcgccgatctggtgctggccggcggcgtcgatgcgctg
tcgcgcgcccacctgctgttttccgacgccatggtgcgctggctgtcgcagtggtacggc
gcgaaaagcttcggcgcgcgggcgcagctgctgacgaaactccgccccggcatgctggtg
ccggtcatcggcctgctgaagggcctgaccgatccggtcatcggcatcaatatggggcag
accgccgaaaacctcgccgcgcgcttcggcatcagccgcacgcagatggatttccacgcc
atgcgctcgcatcagcgcacggccgccgcgctcgacgccggccatttcgatgaaatcgtg
ccgatcgccgacgccggtggacgcatccatatggaggacgacggcatgcggcgcgattcg
tcggtgccgcggctggccaggctgcggccggtattcgatcgcgcgcacggccacatcacg
gccggcaacagttcccaggtgaccgacggtgcggcctggttgctgctggcgtcgcgcagg
gcggtggaggaacacggactgacgccgctcggccgcatcgtcgacaccgagtgggccgga
ctggacccggcacagatgggactcgggccggtgcatgccgccacacccatcctgcagcgg
cacggtctcgggctgaacgatctcgatgcctgggagatcaacgaggctttcgccgcccag
gtcatcggctgcatcgaggcatggaaaagcgacgactactgccgcaccgaactgggtctg
cccggcgcgctgggtgcgctcgacgaacgccggctcaatgtcgacggcggtgccatcgcg
atcggtcacccggtcggcgccagcggtgcgcgcatcgtgctgcatctgctgcacgtgctg
cgccggcagggcggcggtcgcggcatcgcggccatctgcatcggcggcggtcagggtggc
gccatgctggtggaaacgacgtga

DBGET integrated database retrieval system