KEGG   Methyloversatilis sp. RAC08: BSY238_2551Help
Entry
BSY238_2551       CDS       T04449                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00020  Citrate cycle (TCA cycle)
metr00640  Propanoate metabolism
metr00660  C5-Branched dibasic acid metabolism
metr01100  Metabolic pathways
metr01110  Biosynthesis of secondary metabolites
metr01120  Microbial metabolism in diverse environments
metr01130  Biosynthesis of antibiotics
metr01200  Carbon metabolism
Module
metr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
metr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:metr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSY238_2551 (sucC)
   00640 Propanoate metabolism
    BSY238_2551 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BSY238_2551 (sucC)
Enzymes [BR:metr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BSY238_2551 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AOF83304
UniProt: A0A1B3LR27
Position
2746274..2747440
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQAKEVLRRFGVVTPRGVPCFEADQAVAAAESLGGKVWVVKAQIHAGGRGKGGGV
KVAKSLDEVREFANQIMGMQLVTHQTGPAGQKVRRLLIEEGADIRKEYYVAALTDRATQK
VALMASSEGGMDIEEVAHNTPEKIIKVFVDPLVGLTDAQAKELADGIGVPAASQAQAIDT
FRKLYTCYMETDASLAEINPLILEGNGNIKALDAKFNFDSNALYRHEDIVAFRDLDEEDP
AEIEASKFDLSYVSLDGNIGCLVNGAGLAMATMDVIKLYGAEPANFLDVGGGATTEKVTE
AFKIMLRNPNVRGILVNIFGGIMRCDTIATGVVAAAREVHLTVPLVVRMKGTNEDLGKQI
LKDSGLPIIAADSMADAAQKIVAAVAGH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccatgagtatcaggcgaaagaggtattgcgccgtttcggtgtagtgacaccg
cggggcgtgccctgcttcgaagctgatcaggccgtggcagcggccgagtcgctgggtggc
aaggtatgggtggtgaaggcgcagattcacgccggtggccgcggcaagggcggcggcgtc
aaggtggccaagtcgctcgacgaggtgcgtgaattcgccaatcagatcatgggcatgcag
ctggtgactcaccagaccggcccggcgggccagaaggtccgccgcctgctgatcgaggaa
ggcgccgacatcaggaaggaatactacgtcgccgcgctgacggaccgcgccacgcagaag
gtggcgctgatggcgtccagcgaaggcggcatggacatcgaggaagtcgcccacaacacg
ccggaaaagatcatcaaggtgttcgtcgatccgctggtcggactgaccgacgcgcaggcg
aaggaactggcggatggcatcggcgttccggcggcgtcgcaggcccaggccatcgacacc
ttcaggaagttgtacacctgctacatggaaaccgacgcctcgctggcggagatcaatccg
ttgattctcgaaggcaacggcaacatcaaggcgctggacgccaagttcaatttcgactcg
aacgcgctttaccgtcacgaagacatcgtggccttccgtgatctggacgaagaagatccg
gcggaaatcgaagcgtcgaagttcgatctgtcctacgtgtcgctggacggcaacatcggc
tgcctggtcaatggcgccggtctggctatggccacgatggacgtgatcaagctgtacggc
gccgagccggccaacttcctcgatgtcggcggtggtgccacgaccgagaaggtgaccgag
gcgttcaagatcatgctgcgcaatcccaatgtacgcggcatcctggtcaacatcttcggc
ggcatcatgcgctgcgacaccattgcgaccggcgtggtcgccgcggcgcgcgaagtgcac
ctgaccgtgccgctggtggtgcgcatgaagggcaccaatgaagacctgggcaagcagatc
ctgaaggattcgggtctgcccatcattgcggccgacagcatggcggatgcggcacagaag
atcgtggccgccgtggccggacactga

DBGET integrated database retrieval system