KEGG   Methyloversatilis sp. RAC08: BSY238_625Help
Entry
BSY238_625        CDS       T04449                                 

Gene name
exaA
Definition
(GenBank) quinoprotein ethanol dehydrogenase
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
metr  Methyloversatilis sp. RAC08
Brite
KEGG Orthology (KO) [BR:metr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY238_625 (exaA)
Enzymes [BR:metr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     BSY238_625 (exaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Motif
Other DBs
NCBI-ProteinID: AOF80904
UniProt: A0A1B3LJ76
Position
681445..683307
Genome map
AA seq 620 aa AA seqDB search
MKTFSLKNPALCIALGALLASPAHAAKTVSWEDIVNDDKTTGDVLTYGLGMKAQRHSPLK
QINTKTVSALSPAWSYSFGGEKQRGQQGQALVHDGVIYITASYSRMYAVEARTGKRLWTY
EHRLPDDIRPCCDVVNRGAAIYGDKVYFGTLDAGMVALNKDTGKVVWSKKWGDHKIGYTM
TGAPFVVKDQKSGRVMLVHGSSGDEFGVIGYLFARDVDTGEEIWARPMVEGHMGRLNGKD
STPTGDAKAPSWPDDPSSPTGKVEAWSHGGGAPWQTASFDVEQNMVVIGTGNPAPWNTWK
RTKEGDSPSKWPSLFTSGQAYVDASSGELKGFFSHTPNDAWDFSGNNSVLLFEYKDPKTG
KQIKASAHADRNGYFFVTDREKLATGAGYPWKQTALIGAWPFVDGITWTKGFDLKTGMPN
VVESQYPPKPKAGEEKGESIFVSPPFLGGTNWMPMSYSPATELFYIPGNHWAMDYWAENV
TYKAGAAYLGQGFRIKKLFDDHVGILRAIDPKTGKIAWEHKEQFPLWAGTLTTAGGLLFT
GTSDGYVKAFDAKTGKEMWKFQTGSGVVSVPITWEQDGEQYVGIASGYGGAVPLWGGDMA
ELTKQVNQGGSFWAFKLPKR
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttttcactgaagaacccggcactttgcatcgcgctcggcgcgctgctggcc
agcccggcccacgccgcgaagacggtgagctgggaagacatcgtcaatgacgacaagaca
accggcgacgtgctgacctacggcctgggcatgaaggcccagcgtcacagcccgctcaag
cagatcaatacgaaaaccgtatcggcgctctcccccgcctggtcctattccttcggtggc
gaaaagcagcgcggccagcaggggcaggcgctggtgcacgacggcgtcatctacatcacc
gcttcgtactcgcgcatgtatgccgtcgaagccagaaccggcaagcggctgtggacctac
gagcaccgcctgcccgacgatatccgcccctgctgcgacgtggtcaaccggggcgccgcc
atctacggcgacaaggtgtacttcggcacgctggacgccggcatggtcgcgctgaacaag
gataccggcaaggtcgtctggtcgaagaagtggggtgaccacaagatcggctacacgatg
accggcgcaccgtttgtcgtgaaggaccagaagagcggccgcgtcatgctggtgcacggc
tcgtcgggtgacgaattcggcgtgatcggctatctgttcgcacgcgatgtcgacaccggc
gaagaaatctgggcgcgccccatggtcgaaggccacatgggccggctcaacggcaaggac
agcacaccgaccggcgacgccaaggcgccgagctggccggatgacccgagctcgccgacc
ggcaaggtcgaagcctggagtcatggcggcggtgccccctggcagaccgcctcgttcgac
gtcgagcagaacatggtcgtgatcggtaccggcaacccggcgccgtggaacacctggaag
cgcaccaaggaaggcgacagcccgagcaagtggcccagcctgttcacgtccggtcaggcc
tatgtcgatgcctcgagcggcgagctgaagggcttcttctcgcacacgccgaatgatgcc
tgggacttctccggcaacaattccgtgctgctgttcgaatacaaggatccgaagaccggc
aagcagatcaaggcatcggcacacgccgaccgcaacggctacttcttcgtgaccgaccgc
gaaaagctcgcgaccggtgccggctacccgtggaagcagacggcgctgatcggcgcctgg
ccgttcgtagatggcatcacctggaccaagggattcgacctgaagaccggcatgcccaat
gtggtcgaaagccagtacccgccgaagccgaaggccggtgaagaaaagggcgaaagcatt
ttcgtgtcaccgcccttcctcggcggcaccaactggatgcccatgtcctacagccctgcg
accgagttgttctacattccaggcaaccactgggcgatggactactgggcggaaaacgtc
acctacaaggcgggtgcggcctacctcggccagggcttccgcatcaagaagctgttcgac
gaccatgtgggcatcctgcgcgcgatcgatccgaagaccggcaagatcgcctgggaacac
aaggagcagttcccgctgtgggccggtacgctgaccaccgccggcggccttttgttcacg
ggtacgtccgacggctatgtgaaggccttcgacgcaaagaccggcaaggaaatgtggaaa
ttccagaccggttccggcgtcgtatcggtacccatcacgtgggaacaggacggcgaacag
tacgtcggtatcgcctccggttacggcggcgccgtgccgctgtgggggggtgacatggcg
gagctgaccaaacaggtgaatcagggcggctcattctgggccttcaagctgccgaagcgc
tga

DBGET integrated database retrieval system