KEGG   Methylobacterium sp. 17SD2-17: DK389_03435Help
Entry
DK389_03435       CDS       T05724                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
mets  Methylobacterium sp. 17SD2-17
Pathway
mets00730  Thiamine metabolism
mets01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mets00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DK389_03435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mets03000]
    DK389_03435
Enzymes [BR:mets01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     DK389_03435
Transcription factors [BR:mets03000]
 Prokaryotic type
  Other transcription factors
   Others
    DK389_03435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AWN44344
UniProt: A0A2U8WDR7
Position
743210..743812
Genome map
AA seq 200 aa AA seqDB search
MPFNAELAAGTLGRARFQHYILQDAHYLVGFGRALSLAAAKAPDPDRMVQFARAAETAIV
VERALHGGFFRDYGIDAATFAGTPLSPSCDHYVSYLLATAYAEPYEVVLAALLPCFWIYA
EVGRDIHARAVPDNPYQAWIDTYAGEDFARAVAEMIAATDEAAASAAPALLARMLRAFTH
ATRLEWMFWDGAYRETAWPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcaacgccgagctcgccgcaggcaccctcggccgggcccggttccagcactac
atcctgcaggacgcgcattacctcgtcggcttcgggcgcgccctgagcctcgcggccgcg
aaggcgccggatccagaccggatggtgcagttcgcccgtgcggccgagaccgcgatcgtg
gtcgagcgcgccctgcacggcggcttcttccgcgactacgggatcgacgccgcgaccttc
gccggcacgccgctctcgccgtcctgcgaccattacgtcagctacctcctggcgacggcc
tacgccgagccttacgaggtcgtgctcgccgccctcctgccctgcttctggatctacgcc
gaggtcggccgcgacattcacgcccgggccgtgcccgacaacccgtaccaagcctggatc
gacacctatgcgggcgaggatttcgcccgggccgttgccgagatgatcgcggcgacggac
gaagcagcggcgtccgccgcgccggcgctcctcgcgcggatgctccgggccttcacgcac
gccacccgcctcgaatggatgttctgggacggcgcctaccgggaaacggcctggcccgtg
tga

DBGET integrated database retrieval system