KEGG   Methylobacterium sp. 17SD2-17: DK389_11530Help
Entry
DK389_11530       CDS       T05724                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
mets  Methylobacterium sp. 17SD2-17
Pathway
mets00670  One carbon pool by folate
mets01100  Metabolic pathways
mets01120  Microbial metabolism in diverse environments
mets01200  Carbon metabolism
Module
mets_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:mets00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DK389_11530
Enzymes [BR:mets01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     DK389_11530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: AWN41041
UniProt: A0A2U8W5Y0
Position
complement(2519979..2521652)
Genome map
AA seq 557 aa AA seqDB search
MPSDIEIARAATLKPIAQVAEKLGIPEDALHNYGKHIAKIDHGYIASLESRPEGKLVLVT
AISPTPAGEGKTTTTVGLGDALNRIGQKTMICLREPSLGPCFGMKGGAAGGGKAQVVPME
QINLHFTGDFHAITSAHSLAAALIDNHIYWANELNIDVRRIFWRRVVDMNDRALRAINQS
LGGVANGFPREDGFDITVASEVMAVFCLAKNLEDLEERLGRIVIAETRDRKLVTLKDVKA
TGAMTVLLKDALQPNLVQTLEGNPALIHGGPFANIAHGCNSVIATRSGLRLADYTVTEAG
FGADLGAEKFIDIKCRQAGLKPSAVVIVATVRALKMHGGVNKKDLGSENIEALERGFENL
ARHVTNVRNFGLPVVVGVNHFYADTDAEHEKLKALCAEKLQVEAITCKHWADGGAGAEAL
AHAVVKLAEGEQKPLAYTYESEGKLTDKIKAIATKLYGASDIQIESKAATKLAAFDKEGY
GHLPVCMAKTQYSFSTDPNLMGAPSGHIIGVRDVRLSAGAGFVVVICGEIMTMPGLPRVP
AADTIRLDANGQIDGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccctcagacatcgagatcgcccgcgcggcgaccctgaagccgatcgcacaggtcgcc
gagaagctcggcatcccggaggacgcgcttcacaattacggcaagcacatcgccaagatc
gaccacggctacatcgcctccctggagagccggcccgagggcaagctcgtcctcgtgacc
gcgatcagcccgacgccggccggcgagggcaagaccacgacgacggtcggtctcggcgac
gcgctgaaccgcatcggccagaagaccatgatctgcctgcgcgagccctcgctcggcccc
tgcttcggcatgaagggcggtgcggccggcggcggcaaggcgcaggtcgtgccgatggag
cagatcaacctgcacttcaccggcgacttccacgccatcacctcggcccactcgctggcc
gcggcgctgatcgacaaccacatctactgggcgaacgagctcaacatcgacgtgcggcgc
atcttctggcgccgcgtcgtcgacatgaacgaccgggctttgcgcgccatcaaccagtcg
ctcggcggcgtcgccaacggcttcccccgcgaggacggcttcgacatcacggtcgcctcc
gaggtgatggcggtgttctgcctcgccaagaacctcgaggacctcgaggagcgcctcggc
cgcatcgtcatcgccgagacccgcgaccgcaagctcgtgaccctcaaggacgtgaaggcc
acgggcgcgatgaccgtgctcctcaaggacgcgctgcagccgaacctcgttcagacgctg
gagggcaacccggccctcatccacggcggccccttcgccaacatcgcccacggctgcaac
tcggtgatcgccacccgctccggcctgcgcctcgccgactacacggtgacggaagccggc
ttcggcgccgatctcggcgcggagaagttcatcgacatcaagtgccgccaggccgggctt
aagccctcggccgtcgtcatcgtcgcgacggtgcgggcgctgaagatgcacggcggcgtc
aacaagaaggacctcggctcggagaacatcgaggccctggagcggggcttcgagaacctc
gcccgccacgtcaccaacgtgcgcaatttcggcctgcccgtcgtcgtcggcgtcaaccac
ttctacgccgacaccgacgccgagcacgagaagctgaaggcgctgtgcgccgagaagctg
caggtcgaggccatcacctgcaagcactgggcggatggtggcgccggcgcggaggccctc
gcccacgcggtggtgaagctcgccgagggcgagcagaagccgctcgcctacacctacgag
tccgagggcaagctcaccgacaagatcaaggccatcgcgacgaagctctacggggcgtcc
gacatccagatcgagtcgaaggccgccaccaagctcgccgccttcgacaaggagggctac
ggccacctgccggtctgcatggccaagacccagtactcgttctcgacggacccgaacctg
atgggcgcgccgtcgggccacatcatcggggtgcgcgacgtccgcctctccgcgggcgcc
ggcttcgtggtggtgatctgcggtgagatcatgaccatgccgggcctgccccgggtcccg
gccgcggacacgatccgcctcgacgcgaacggccagatcgacgggttgttctga

DBGET integrated database retrieval system