KEGG   Methylobacterium sp. 17SD2-17: DK389_16050Help
Entry
DK389_16050       CDS       T05724                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
mets  Methylobacterium sp. 17SD2-17
Pathway
mets00051  Fructose and mannose metabolism
mets00520  Amino sugar and nucleotide sugar metabolism
mets01100  Metabolic pathways
mets01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mets00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DK389_16050
   00520 Amino sugar and nucleotide sugar metabolism
    DK389_16050
Enzymes [BR:mets01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DK389_16050
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     DK389_16050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding Mtf2_C
Motif
Other DBs
NCBI-ProteinID: AWN41744
UniProt: A0A2U8W6N1
Position
3481894..3483306
Genome map
AA seq 470 aa AA seqDB search
MIRPVILCGGSGTRLWPASRESMPKQFSRLVSEHSSTFQDTARRVTDETTFGRLSVLTHT
DARFIVAEQLAEARIPADILLEPERRDSAAAVAVATLHAARTDPQAVVLILAADHVIGDT
RAFVAAVEAAAVGARAGHIMTLGIEPTQPATAYGYIHPGEAIPDAPGTYKIARFVEKPDR
HGAERLIAEGAVWNSGYFLFRADVMLDELEAHAPAVLSAARAALENAARDLDFVRLDADA
FAQAPKTSIDYAVMERTRHAGVLPVSFAWSDVGTWDAVWSVLAQDESGNAVRGRVELIET
RGSLVHSEGEQVTAVVGLEDVVVVSTPDAVLVSSKARSGEVKTLVERLRAKAYPEADAHR
RMYRPWGWYQRIDIGERFQVKRIMVTPGGRLSLQKHYHRAEHWVVVKGTAEVTLNERVVL
VHENEAIYLPIGSMHRLSNPGKIPLELIEVQVGSYTGEDDIIRVEDVYGR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaccagtgatcctgtgcggcggctcgggcacgcggctgtggcccgcctcccgc
gagagcatgccgaagcagttctcgcgcctcgtcagcgagcattcctccaccttccaggac
acggcccggcgggtcaccgacgagaccacgttcggccgcctcagcgtgctcacccacaca
gacgcccgcttcatcgtcgccgagcagctcgccgaggcccgcatccccgccgacatcctg
ctcgagcccgagcggcgcgattccgccgccgcggtcgccgttgcaacgctccatgccgcc
cgcaccgacccgcaggccgtcgtcctgatcctggccgccgaccacgtcattggcgacacc
cgggcgttcgtcgccgccgtcgaggccgccgcggtcggcgcgcgcgccggccacatcatg
acgctcggcatcgaaccgacgcagccggcgaccgcctacggctacatccaccctggcgag
gccatccccgacgcccccggcacctacaagatcgcccgcttcgtcgagaagccggaccgg
cacggcgccgagcgcctgatcgcggagggcgcggtctggaattcgggctacttcctgttc
cgcgccgacgtgatgctcgacgagctggaggcgcacgcgcccgccgtgctctcggccgcc
cgggccgccctggagaacgcggcgcgggacctcgacttcgtgcgcctcgacgcggacgcc
ttcgcgcaggcccccaagacctcgatcgactacgcggtgatggagcggacgcgccacgcg
ggcgtgctgccggtctccttcgcgtggtcggatgtcggcacctgggacgcggtctggagc
gtgctggcgcaggacgagagcgggaacgcggtgcgcggccgcgtcgagctgatcgagacc
cgcggcagcttggtccacagcgagggcgagcaggtcaccgcggtggtggggctcgaggac
gtcgtggtggtctcgacccccgacgcggtgctggtgagctcgaaggcgcgctcgggcgag
gtgaagacgctggtggagcggctgcgcgcgaaggcctacccggaggcggacgcgcaccgg
cggatgtaccggccctggggctggtaccagcgcatcgacatcggcgagcgtttccaggtg
aagcggatcatggtgacgccgggcgggcgcctctccttgcagaagcactatcaccgggcg
gagcactgggtggtggtgaagggcacggccgaggtgacgctgaacgagcgggtcgtgctg
gtccacgagaacgaggcgatctacctgccgatcggctcgatgcaccgcctgtcgaacccg
ggcaagatcccgctggagctgatcgaggtccaggtcggatcctacaccggcgaggacgac
atcatccgcgtcgaggacgtgtacggacgctga

DBGET integrated database retrieval system