KEGG   Methylobacterium sp. 17SD2-17: DK389_31445Help
Entry
DK389_31445       CDS       T05724                                 

Definition
(GenBank) methyltransferase
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
mets  Methylobacterium sp. 17SD2-17
Pathway
mets00906  Carotenoid biosynthesis
mets01100  Metabolic pathways
mets01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mets00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    DK389_31445
Enzymes [BR:mets01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     DK389_31445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_23 Methyltransf_25 Methyltransf_12 Methyltransf_11 MTS Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AWN44206
UniProt: A0A2U8WFV5
Position
complement(6691126..6692313)
Genome map
AA seq 395 aa AA seqDB search
MSPRAGTAPAQDAPVRASTWRETWRERWRAFRNARVASPAFQRWAAGFPLTRRVARANTR
ALFDLCAGFVYAQVLYACIRLDLFRLLADGPMGAEALAQRLRLAPDRAERLLRAAASLDL
LARLPDGRYALADLGAALIGNPSIAAMIEHHAMLYDDLRDPVALLRGEAGPTRLSAYWPY
AEAADSGAIPAEAVAGYSGLMSASQALIAEDVLDAYPFADHACLLDVGGGEGTFAAAAAR
RFPGLRPMLLDLPPVAERARASLAAQGLASRIACHGGSFLDSPLPRGADVITLVRIVHDH
DDGPALRLLRAARAALPPGGRLVIAEPLAGTPGAEPIGDAYFGFYLLAMGSGRARSADEL
GRMLTEAGFTGIRTRATRRPLLAGMVVASRPFENV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgggccggcaccgcgcccgcgcaggacgcgcccgtccgggcctcgacctgg
cgcgagacgtggcgcgagcgctggcgggccttccgcaacgcgcgggtggcgagcccggcc
ttccagcgctgggccgccggcttcccgctgacgcgacgggtggcgcgcgccaacacccgc
gccctgttcgacctctgcgccggcttcgtctacgcgcaggtgctctacgcctgcatccgc
ctcgacctgttccgcctcctggcggacgggccgatgggcgccgaggcgctggcccagcgc
ctgcggctcgccccggaccgcgccgagcgcctgctccgggcggccgcctccctcgacctc
ctcgcccgcctgcccgacgggcgctacgcgctcgccgatctcggcgcggcgctgatcggc
aacccctcgatcgccgcgatgatcgagcaccacgcgatgctctacgacgacctgcgcgat
cccgtggcgctcctgcgcggcgaggcgggcccgacccggctgtcagcctactggccctac
gccgaggcggcggattccggggcgatcccggccgaggccgtggccggctacagcggcctg
atgtcggcctcgcaggccctgatcgccgaggacgtcctcgacgcctatcccttcgccgac
catgcctgcctgctggatgtcggcggcggggagggcaccttcgcggccgccgcggcgcgg
cgcttcccgggcctgcgcccgatgctcctcgacctgccgcccgtggccgagcgggcgcgc
gccagcctcgccgcgcagggcctggcgagccgaatcgcctgccacggcggcagcttcctc
gattcgcccctgccgcggggcgccgacgtgatcacgctcgtgcgcatcgtccacgaccac
gacgacgggccggccctgcgcctcctgcgcgccgcccgcgccgcgctgccccccggcggc
cgcctcgtcatcgccgaaccgttggccggcacaccaggcgccgagccgatcggcgacgcg
tatttcggcttctacctcctggcgatgggcagcgggcgggcgcgctcggcggacgagctc
ggccgcatgctgacggaggccggattcaccgggatccggacgcgcgcgacccgccgcccg
ctgctcgccggcatggtcgtcgcctcacgtccgtttgagaatgtgtaa

DBGET integrated database retrieval system