KEGG   Methanobacterium sp. BRmetb2: CIT01_06840Help
Entry
CIT01_06840       CDS       T05692                                 

Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mett  Methanobacterium sp. BRmetb2
Pathway
mett00300  Lysine biosynthesis
mett00680  Methane metabolism
mett01100  Metabolic pathways
mett01120  Microbial metabolism in diverse environments
mett01130  Biosynthesis of antibiotics
mett01210  2-Oxocarboxylic acid metabolism
mett01230  Biosynthesis of amino acids
Module
mett_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mett00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CIT01_06840
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CIT01_06840
Enzymes [BR:mett01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     CIT01_06840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: AXV37934
UniProt: A0A347AG37
Position
1365471..1366724
Genome map
AA seq 417 aa AA seqDB search
MNITEKILARASQKREVNPGELIKVDVDLAMTHDGTSPPTINTFKKIADTVWDNEKIVIV
FDHNLPANNIGSAEFQKVTRKFAREQGIKNIYTHGEGICHQVLPEKGYINPGKVIVGADS
HTCTYGAFGAFATGVGATDMAMIFATGRTWFMVPEAYEIIITGNLGPYTTAKDVILNVIG
EIGSYGATYKSLEFHGETVESLDVSGRMTMCNMAVEMGAKNGIMEPNPLTLKYLKERSGD
SFEIVRSDKDSQYEKEYLFDINDMEPQVACPHNVDNVKNISKVEGVHIDQAFIGSCTNGR
LEDLRIASQILEDKKVHPDVRLIVIPASAEIYSNALKEDIIDKFISAGAIVCNPGCGPCL
GAHMGVIGSGETAIATTNRNFLGRMGDPDSEVYLANPAVVASSAVEGVIKNPESLVK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaccgagaaaatcttagcaagggcctcccaaaaaagggaagttaatcccggc
gaactaattaaggtagatgtagatctagcaatgacacatgatggaacctccccacctacc
ataaatacatttaaaaaaattgcagatacagtatgggataatgaaaagattgttattgtt
tttgatcataatttacctgcaaataatattggttctgcagaatttcaaaaagtaactcgg
aaatttgccagggaacaagggataaagaatatttacactcatggagagggcatatgtcat
caggttctccctgaaaaaggatatataaaccctggaaaagttattgtaggtgcagattct
cacacatgtacttatggggcctttggagcatttgctacaggtgtaggggctacagatatg
gctatgatttttgcaaccggcaggacatggtttatggttcctgaagcatatgaaatcatt
ataactggtaatttaggaccatatacaactgcgaaagatgttattttgaatgttattggt
gaaattggctcttatggagcaacatataaatcacttgaatttcacggagaaacagtagaa
tccctggatgtatcgggaagaatgaccatgtgtaatatggcagtggaaatgggggcaaaa
aatggaataatggaacctaatcctctgacattgaaatatttaaaagaaaggtccggtgat
tcttttgagatagtaagatctgataaagattcccaatatgaaaaagaatatttatttgat
ataaatgatatggaaccgcaggtggcatgtccacataatgtagataatgtaaaaaatatt
tccaaggtcgaaggggtgcacatagatcaggcttttataggttcatgcaccaatggtcgt
ctggaagatttaagaatagcatcccaaatcttggaagataaaaaggtacacccggacgtt
cgtttaatagtaatccccgcttctgcagaaatttattctaatgccttaaaagaagatatt
attgacaaatttatatctgcaggagcaatagtttgtaatcctggttgtgggccttgttta
ggtgctcacatgggagtaataggctctggggaaacagcgatcgccaccaccaaccggaac
tttttaggaagaatgggcgaccctgattcagaagtttatctggcaaatcctgctgtggta
gcatcttcagcagtagagggcgtaattaaaaacccggaatcattagttaaatga

DBGET integrated database retrieval system