KEGG   Methylobacterium sp. XJLW: A3862_09210Help
Entry
A3862_09210       CDS       T05508                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00970  Aminoacyl-tRNA biosynthesis
metx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3862_09210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:metx03029]
    A3862_09210
Enzymes [BR:metx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A3862_09210
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A3862_09210
Mitochondrial biogenesis [BR:metx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A3862_09210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWV15668
UniProt: A0A2U9TZX5
Position
complement(2029493..2030905)
Genome map
AA seq 470 aa AA seqDB search
MTTAVTDALWPLPITELARRIAARELSSADLVGASLDRIARLDGALNSFVHLSSAALDAA
RAADAEITRSGPRGPLHGIPIAIKDNYTTADMPTRAGTAVEALTFPAADSHAVARLRAAG
AVILGKLRMHEFAWGMVTPPTRNPWDLDRVPGGSSGGSGAAVAARLCPAALGSDTGGSIR
IPAALCGVVGLKPTYGRVGRSGIVPHSWSLDHAGPLTLTVADSALMLQALAGPDAGDPAA
SAAPVPDYTAGLDRPIRGLRVAVIRNHFFDAVDEDVAVAIEGALRFLADRGCTVRDVAVP
SLRHGLGAIYAIELASSTAYHDRSLAQGHVAGFAADVRDLVEMGRLVTGPDYLRAEQVRA
LIMDEMAAVLAEADVIVGPASPLTAWRTDESAVSLGGRAESVLAASWRLTYPFNLTGLPA
IALPCGFDRRGLPISLQIAGRPFAEAEILRVAHQYERAHDWWRRVPPLAG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgccgtgactgacgccctctggccgttgccgatcaccgagctcgcgcggcgg
atcgcggcgcgggagctgtcgagcgccgacctcgtcggcgccagcctcgaccggatcgcg
cgcctcgacggcgccctgaacagcttcgtccatctctcgtccgcggccctcgacgccgcg
cgcgcggccgatgccgagatcacccggtccggcccgcggggcccgctgcacggcatcccg
atcgccatcaaggacaactacaccacggccgacatgccgacccgggcgggtaccgccgtg
gaggccctgaccttcccggcggccgacagccacgcggtggcgcggctgcgggcggccggc
gcggtgatcctcggcaagctgcgcatgcacgaattcgcctggggcatggtcacgccgccg
acccgcaatccctgggacctcgaccgggtgcccggcggctccagcggcggctccggcgcc
gcggttgcggcccgcctctgcccggccgccctcggctcggacacgggcggctcgatccgg
atcccggccgccctgtgcggggtcgtcggcctcaagccgacctacggccgggtcggccgg
tcggggatcgtcccgcattcctggtccctcgaccatgccgggccgctgaccctgacggtg
gccgattccgccctgatgctgcaggcgctcgccggcccggatgccggcgatcccgccgcc
agcgcggcgccggtccccgactacacggccgggctggaccggccgatccggggcctgcgc
gtcgcggtgatccgcaaccacttcttcgacgcggtcgacgaggacgtcgctgtcgcaatc
gagggggcgctccgcttcctcgccgaccggggctgcacggtccgcgacgtcgcggtgccg
tccctgcgccacggcctcggggccatctacgccatcgagctcgcctcctcgaccgcctat
cacgaccgcagcctcgcccagggccacgtggcgggctttgccgccgacgtccgcgacctc
gtggagatgggccggctcgtgaccgggccggactacctgcgcgccgagcaggtgcgggcc
ctgatcatggacgagatggccgccgtcctggcggaggccgacgtgatcgtcggcccggcc
tcgcccttgaccgcgtggcggacggacgagtccgcggtgtcgctcggcgggcgcgcggag
agcgtgctggcggcctcctggcggctgacctacccgttcaacctcacgggcctgcccgcg
atcgcgctgccctgcggcttcgaccggcgcggcctgccgatcagcctccagatcgccggc
cggcccttcgccgaagccgagatcctgcgcgtggcgcaccagtacgagcgggcgcacgat
tggtggcgccgggtgccgcccctggccggctga

DBGET integrated database retrieval system