KEGG   Methylobacterium sp. XJLW: A3862_10695Help
Entry
A3862_10695       CDS       T05508                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:metx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A3862_10695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:metx02022]
    A3862_10695
Two-component system [BR:metx02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   A3862_10695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Gamma_PGA_hydro Penicillinase_R
Motif
Other DBs
NCBI-ProteinID: AWV19402
UniProt: A0A2U9U2S0
Position
2369832..2370539
Genome map
AA seq 235 aa AA seqDB search
MSNAARADLPDEAPHVLVVDDDRRLRELLARYLTDQGFRVTAAASAAEARARAQSVVFDA
MVLDVMMPGENGFDYARSVRETSRVPILMLTARSNPNDRVMGLEIGADDYLPKPFEPREL
TLRLNNIIKRSARPRAAAAEAVTFGPFAFRVDRGELRRDDELIRITEREREILTILAMAG
GANVEREQLAGPGGAAAERTVDVQINRLRRKTEVDPANPVFLQTVRGVGYRLAVD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatgccgcccgggccgacctgcccgacgaggcgccccacgtcctcgtggtcgac
gacgaccgccggctgcgcgaattgctcgcccgctacctcaccgaccagggcttccgggtc
accgccgcggcgagcgccgcggaggcgcgggcccgggcccagagcgtcgtgttcgacgcc
atggtcctcgacgtgatgatgcccggcgagaacggcttcgactacgcccgcagcgtgcgc
gagacgtcgcgggtgccgatcctgatgctcaccgcccgctccaacccgaacgaccgggtg
atggggctggagatcggcgcggacgattacctgcccaagcccttcgagccgcgggagctg
acgctgcggctcaacaacatcatcaagcgcagcgcgcggccccgcgcggcggccgccgag
gcggtgaccttcgggccgttcgcgttccgggtcgaccggggcgagctgcgccgggacgac
gagctgatccgcatcaccgagcgcgagcgcgagatcctgacgatcctggcgatggcgggc
ggcgccaatgtcgagcgcgagcagctcgccggcccgggcggggccgcggcggagcgcacc
gtcgacgtgcagatcaaccgcctgcgccgcaagaccgaggtcgaccccgccaatccggtc
ttcctgcagactgtgcggggcgtcggctaccggctcgcggtggattga

DBGET integrated database retrieval system