KEGG   Methylobacterium sp. XJLW: A3862_11800Help
Entry
A3862_11800       CDS       T05508                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00480  Glutathione metabolism
metx00590  Arachidonic acid metabolism
metx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A3862_11800
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A3862_11800
Enzymes [BR:metx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A3862_11800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AWV16102
UniProt: A0A2U9TTC5
Position
2596862..2597416
Genome map
AA seq 184 aa AA seqDB search
MTLLRREALILIGAGLAGTARAAEAMRATDFAFETPEGAPMPLSAYAGKPILVVNTATAC
GYAGQLSGLQTLWTRFGDRGLTVLGVPSPDFGNQEPLDGPAIAEAARKNHGVTFPLTAKT
RVKMPGAHPFYRWAAAERPAETPRWNFHKYLIARDGTLAAAFATQVEPTDPRVISGIAAA
LDQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgctgcgccgcgaggctctcatcctgatcggtgccggccttgccggcactgcc
cgcgccgccgaggccatgcgggccacggacttcgccttcgagacgcccgagggcgcgccg
atgccgctctcggcctatgcgggaaagccgatcctggtggtcaacaccgccacggcctgc
ggctatgccgggcaactctccgggctccagacgctctggacgcggttcggcgaccggggg
ctcacggtcctgggcgtgccctcgccggatttcggcaatcaggagccgctggacgggccg
gccatcgcggaggccgcccggaagaatcacggcgtcacctttccgctcaccgccaagacc
cgggtgaagatgccgggcgcccacccgttctaccgctgggcagcggccgagcgcccggcc
gagacgccgcgctggaattttcacaagtacttgatcgcccgggacggcaccctggcggcg
gccttcgccacgcaggtcgagccgacggatccgcgggtgatctcgggcatcgcggcagcc
ctcgatcaggcctga

DBGET integrated database retrieval system