KEGG   Methylobacterium sp. XJLW: A3862_22085Help
Entry
A3862_22085       CDS       T05508                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00030  Pentose phosphate pathway
metx01100  Metabolic pathways
metx01120  Microbial metabolism in diverse environments
metx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3862_22085
Enzymes [BR:metx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A3862_22085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776 Glyco_transf_5 GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AWV17869
UniProt: A0A2U9UBQ4
Position
complement(4859210..4859980)
Genome map
AA seq 256 aa AA seqDB search
MSFTDTRALVTGADSGIGQATAELLARAGADVAITYHSDADGIRETAARVEAAGRRALVL
QLDVGDPAAVTAAFDRIGSELGTLDILVANAGQAMSGIPVAEMDDAVLERILRVNLMGPL
FCARPFIKMRRAQGGNGKIVFVSSVAQHLPTPESAPYGMSKAGLGSLCRSLSRELAEDRI
NVNNVAPGLIETPMTADRFERSEVLDQSLERIPWHRAGQPEEIAQAILYLASDAAAYVTG
HTLVVDGGLTMQWGGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaccgacacccgtgccctggtcaccggggccgattccggcatcgggcaggcg
acggcggaactgctcgcccgggcaggcgccgacgttgcgatcacctatcacagcgacgcg
gacggcatccgcgagaccgccgcgcgggtcgaggccgcgggccgccgggccctggtgctc
cagctcgatgtcggcgatccggcggccgtcacggcggccttcgaccgtatcggcagcgag
ctcggcaccctcgacatcctcgtggccaatgccggacaggccatgagcgggataccggtc
gccgagatggacgacgcggtcctggagcggatcctgcgggtgaacctcatgggaccgctg
ttctgtgcgcgccccttcatcaagatgcgccgagcgcagggcgggaacggcaagatcgtg
ttcgtctcctccgtggcccagcacctgcccacccccgagagcgcgccctacgggatgtcg
aaggcggggctcggctccctctgccgctccctgtcgcgggaactcgccgaggaccggatc
aacgtcaacaatgtcgccccgggcctgatcgagacgccgatgaccgcggaccggttcgag
cggtcggaggttctggaccagtccctggagcggatcccgtggcatcgggccggccagccg
gaggagatcgctcaagcgatcctgtatctggcctcggatgccgcggcctatgtcaccggc
cacactctggtggtcgatggcggcttgacgatgcagtggggtggcgcctga

DBGET integrated database retrieval system