KEGG   Methylobacterium sp. XJLW: A3862_23315Help
Entry
A3862_23315       CDS       T05508                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00450  Selenocompound metabolism
metx00970  Aminoacyl-tRNA biosynthesis
metx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A3862_23315
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3862_23315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:metx01007]
    A3862_23315
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:metx03016]
    A3862_23315
Enzymes [BR:metx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A3862_23315
Amino acid related enzymes [BR:metx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A3862_23315
Transfer RNA biogenesis [BR:metx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A3862_23315
 Prokaryotic type
   Other AARSs
    A3862_23315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AWV18073
UniProt: A0A2U9U3Y6
Position
complement(5142090..5143667)
Genome map
AA seq 525 aa AA seqDB search
MTSNAPAPLKKTFGLSTAISYPNGAPHIGHAYEVIAADAIARFHRLDGYDVLFSTGTDEH
GLKIQQAATRAGTTPRAYVDGTAARFQAMADRLDCAYDRFIRTTEPGHSAAAQEIWRRME
ANGDIYLDKYAGWYSVRDEAYYDEAETRLLEDGSRRSLATDTPVVWMEEENFLFRLSAYQ
DRLLQLYADQPDFIGPDTRRNEVASFVRSGLKDLSVSRTNFDWGVPVPGHPSHVMYVWVD
ALTNYLTVTGFPDESDPRKKFWPMDLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHG
FLLSKGEKMSKSLGNVLDPFELADTYGVDPVRYFVLREVPFGGDGSYSHEAIIGRINADL
ANDLGNLAQRSLSMVAKNCDGAVPDPGSLDEADRALLAQVDALPERARTLMGDLALHSIL
AEIWAVVAEANRYFAAQEPWRLRKSDPARMNAVLYTTLEALRVFGILTQPFVPGAAAKLL
DLLAVPADRRSLAAVGEGGRLVPGTALAAPAPIFPRFERPETPSA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccaacgccccggcgcccctgaaaaaaaccttcggcctctcgaccgcgatctcc
taccccaacggcgcgccccatatcggccatgcctacgaggtgatcgccgccgacgccatc
gcgcgcttccaccggctcgacggctacgacgtgctgttctccaccgggaccgacgagcac
gggctgaagatccagcaggccgcgacccgggccggcaccaccccgcgcgcgtatgtcgac
ggcaccgccgcccggttccaggcgatggccgaccggctggactgcgcctacgaccgcttc
atccgcaccaccgagcccggccattccgccgccgcccaggagatctggcggcggatggag
gccaacggcgacatctacctcgacaaatatgccggctggtactcggtccgcgacgaggcc
tattacgacgaggccgagacccggctcctggaggacggcagccgccgcagcctcgccacc
gacacgccggtcgtgtggatggaggaggagaatttcctgttccggctctccgcctatcag
gaccggctgctgcagctctacgcggaccagcccgacttcatcgggccggacacccgccgg
aacgaggtggcgagcttcgtgcgctccggcctcaaggacctctcggtcagccgcaccaat
ttcgactggggcgtgccggtgcccggccatccgagccacgtcatgtacgtgtgggtcgat
gcgctcaccaattatctcaccgtcaccggcttccccgacgagtccgatccgcgaaaaaaa
ttctggccgatggatctgcacatcatcggcaaggacatcgtccggttccacgcggtctac
tggccggccttcctgatgtcggccgggctgcccctgcccaagcgcgtcttcggccacggc
ttcctgctctccaagggcgagaagatgtcgaagtcgctgggcaacgtcctcgacccgttc
gagcttgccgacacctacggcgtcgacccggtgcgctacttcgtgctgcgcgaggtgccg
ttcggcggcgacggcagctacagccacgaggcgatcatcggccggatcaacgccgatctc
gccaacgacctcggcaacctcgcccagcgctcgctctcgatggtggccaagaactgtgac
ggtgcggtgccggatccgggcagcctggacgaggccgaccgcgccctgctcgcccaggtc
gatgccctgccggagcgcgcccgcaccctgatgggcgacctcgcgctgcacagcatcctc
gccgagatctgggccgtggtggcggaggcgaaccgctacttcgccgcccaggagccctgg
cgcctgcgcaagtccgacccggcgcggatgaacgccgtgctctacacgacgctggaggcg
ttgcgcgtcttcggcatcctgacccagcccttcgtgccgggggcggccgccaagctcctc
gacctgctggcggtgccggccgaccggcgcagcctcgccgccgtgggggaggggggccgg
ctcgtgccgggcacggcgctcgccgcccccgcgccgatcttcccgcgcttcgagcgcccc
gagaccccgtccgcctga

DBGET integrated database retrieval system