KEGG   Methylobacterium sp. XJLW: A3862_23525Help
Entry
A3862_23525       CDS       T05508                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00860  Porphyrin and chlorophyll metabolism
metx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A3862_23525
Enzymes [BR:metx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     A3862_23525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AWV18109
UniProt: A0A2U9UCF0
Position
complement(5188661..5190103)
Genome map
AA seq 480 aa AA seqDB search
MIQGTGSDVGKSLLVAGLARAFTERGLRVRPFKPQNMSNNAAVTADGGEIGRAQALQARA
ARVAPSVHMNPVLLKPQSEVGSQVVVQGRMVATVKARDYQAWKPRLMSAVLDSFSRLAGE
ADLVLVEGAGSASEVNLRAGDIANMGFARATDTPVVLVGDIDRGGVIASLVGTKAVIDPE
DAALIAGFLVNRFRGDPSLFADGMRLIAERTGWAALGLVPHFPDAARLPAEDVLGLAGSE
SRGPGAVTVAVPVLPRIANFDDLDPLRAEPNVSVVLVRPGTPIPAEAALVLLPGSKTTID
DLEAFRQEGWDVDLRAHIRRGGRVLGLCGGYQMLGNSLADPHGIEGAPRTVAGLGLLDVD
TVMTPEKRLAAVTGTSLPDGVHFAGYEMHIGATEGPDAARPLLRLADGRLDGAVSADGRV
AGTYVHGLFAHDAQRAAWLARLGTASDGLGYEAGVEAALDGLARHIAAHVDCDRLLALAR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatccagggcaccggctccgatgtcggcaagtcgctgctcgtggcggggctggcgcgc
gccttcacggagcggggcttaagggtccggccgttcaagccgcagaacatgtcgaacaac
gccgccgtcaccgccgatggcggcgagatcggccgcgcgcaggccctccaggcccgggcc
gcccgggtggcgccctccgtccacatgaacccggtcctgctcaagccgcagagcgaggtc
ggctcccaggtggtggtgcagggccggatggtcgccaccgtgaaggcgcgcgactaccag
gcctggaagccccggctgatgtcggccgtcctcgacagcttctcccggctcgccggggag
gcggatctggtcctcgtcgagggcgcgggctcggcctcagaggtgaacctgcgggccggc
gacatcgccaatatgggcttcgcccgggccaccgacacgccggtggtgctggtcggcgac
atcgaccggggcggggtgatcgcgagcctcgtcggcaccaaggcggtgatcgacccggag
gacgccgccctgatcgcgggcttcctcgtcaaccgcttccgcggcgacccgagcctgttc
gccgacggcatgcggctgatcgccgagcgcaccggctgggcggctctgggcctcgtgccg
cacttccccgatgccgcgcgcctgccggccgaggacgtgctggggctcgccggctcggag
tcgcgcgggcccggagccgtcacggtggcggtgccggtgctgccgcgcatcgccaatttc
gacgacctcgaccccctgcgggcggagccgaacgtgtcggtggtgctggtccggcccggc
acgccgatccccgccgaggccgccctcgtgctgctgccgggctccaagaccacgatcgac
gacctggaggcctttcgccaggagggctgggacgtcgacctgcgcgcccatatccgccgg
ggcgggcgggtgctcggcctgtgcggcggctaccagatgctgggcaacagcctcgccgac
ccgcacgggatcgagggcgcgccccgcacggtggcgggcctcgggctcctcgacgtcgac
accgtcatgacccccgagaagcgcctcgcggcggtcaccggcacgagcctgccggacggc
gttcattttgccggctacgagatgcatatcggcgcgacggagggccccgacgccgcccgg
ccgctcctgcgcctcgccgacgggcgcctggacggggcggtctcggcggacgggcgcgtg
gccggcacctacgtgcacggcctgttcgcccacgatgcccagcgggcggcctggctcgcg
cgcctcgggacggcctcggacggcctgggctacgaggccggggtcgaggcggcgctggac
ggcctcgcgcgacacatcgcggcccatgtcgactgcgaccgcctcctggcgcttgcccgg
tag

DBGET integrated database retrieval system