KEGG   Methylobacterium sp. XJLW: A3862_25970Help
Entry
A3862_25970       CDS       T05508                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00020  Citrate cycle (TCA cycle)
metx00640  Propanoate metabolism
metx00660  C5-Branched dibasic acid metabolism
metx01100  Metabolic pathways
metx01110  Biosynthesis of secondary metabolites
metx01120  Microbial metabolism in diverse environments
metx01130  Biosynthesis of antibiotics
metx01200  Carbon metabolism
Module
metx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
metx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3862_25970
   00640 Propanoate metabolism
    A3862_25970
   00660 C5-Branched dibasic acid metabolism
    A3862_25970
Enzymes [BR:metx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A3862_25970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AWV18542
UniProt: A0A2U9U0D8
Position
complement(5751362..5752246)
Genome map
AA seq 294 aa AA seqDB search
MSVMIDANTKVICQGFTGKNGTFHSEQAIAYGTKMVGGTSPGKGGSTHLGLPVFDTVAEA
REATGADASVVYVPPPGAADAICEAIAAEIPLIVCITEGIPVLDMVKVKRALTGSKSRLV
GPNCPGIVTAGESKIGIMPANIFRQGSVGIVSRSGTLTYEAVFQTSNAGLGQTTAVGIGG
DPVKGTEFIDVLELFLADPKTESIVMIGEIGGSAEEEAAQFLKDEAKRGRKKPMVGFIAG
RTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGSTLVEVLKG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgatgatcgacgccaacaccaaggtcatctgccagggtttcaccggcaagaac
gggaccttccactccgagcaggccatcgcctacggcaccaagatggtcggcggcacgagc
cccggtaagggcggctcgacgcatctcggcctgccggtgttcgacacggtggccgaggcc
cgcgaggccacgggcgccgatgcctcggtggtctacgtgcccccgcccggcgccgccgac
gcgatctgcgaggcgatcgccgccgagatcccgctgatcgtctgcatcaccgagggcatt
ccggtgctcgacatggtcaaggtgaagcgggcgctcaccggctcgaagtcgcgtctggtc
gggccgaactgcccgggcatcgtcacggcgggcgaatcgaagatcggcatcatgccggcc
aacatcttccggcaaggctcggtcggtatcgtctcgcgttccggcacgctgacctacgag
gcggtgttccagacctccaatgccggcctcggccagaccaccgcggtgggcatcggcggc
gacccggtgaagggcaccgagttcatcgacgtgctggagctgttcctggccgacccgaag
accgagtcgatcgtgatgatcggcgagatcggcggctcggccgaggaggaggctgcgcag
ttcctgaaggacgaggccaagcgcgggcgcaagaagccgatggtcggcttcatcgccggc
cgcacggcgcctccgggccgccgcatgggtcatgccggcgcgatcatctcgggcggcaag
ggcggcgccgaggacaagatcgccgccatggaggccgcgggcatccgcgtgtcgccgtcg
ccggcccggctgggctcgacgctcgtcgaggtcctgaagggctga

DBGET integrated database retrieval system