KEGG   Methylobacterium sp. XJLW: A3862_26550Help
Entry
A3862_26550       CDS       T05508                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00770  Pantothenate and CoA biosynthesis
metx01100  Metabolic pathways
Module
metx_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A3862_26550
Enzymes [BR:metx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A3862_26550
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A3862_26550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF2399 YjeF_N
Motif
Other DBs
NCBI-ProteinID: AWV18649
UniProt: A0A2U9UDZ3
Position
5873005..5874228
Genome map
AA seq 407 aa AA seqDB search
MTETLAQRRVLLVIGGGIAAYKALDLIRRLRERGASVCPVLTAGAQEFVTPLAAAALAGE
RAHTDLFDRASEAEIGHIKLARQADAVVVAPATANLMARMAGGHAADLATTVLLATTLPI
LIAPAMNVQMWAHPATRRNRAVLEGDGVRIVGPNAGRMAEPESGPGRMAEPNEIADALER
MLGQQAGDRPLAGRRVLVTSGPTHEPIDPVRYIANRSSGRQGHAIAAAAAAAGAAVTLVS
GPVALPDPPGVAVVRVETARQMLEAVEAALPADIAVFAAAVADWRPEQEAGSKKIKKDGT
GPAPMPLVENPDILATIARLPVGRPPLVVGFAAETDTVVEHARAKIARKGCDLIVANDVS
AEGGVMGGADNTVHLIRRDGAVETWPRLGKEEVARRLVAHVAGLLAG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccctcgcccagcgccgcgtcctcctcgtcatcggcggcggcatcgcggcc
tacaaggccctcgacctgatccggcgcctgcgcgagcgcggcgccagcgtctgcccggtg
ctgaccgcgggggcgcaggaattcgtgacgccccttgccgccgccgcgctcgccggcgag
cgggcccataccgacctgttcgaccgggcttccgaggccgagatcggccacatcaagctc
gcccgtcaggcggatgccgtggtggtggcgcccgcgaccgccaacctgatggcccgcatg
gccggcggccacgcggccgacctcgcgaccacggtcctgctggcgacgacccttccgatc
ctgatcgcgccggccatgaacgtccagatgtgggcgcatccggccacccgccggaaccgc
gcggtcctggagggcgacggcgtccggatcgtggggccgaatgccggccggatggcggag
cccgaatccggccccggccgcatggccgagcccaacgagatcgccgatgcgctggagcgg
atgctcggccagcaggccggggacaggcccctggccggtcggcgcgtgctcgtgacctcc
ggtcccacccacgagccgatcgatccggtccgctacatcgccaaccgctcctccggccgc
cagggccacgccatcgcggcggccgccgctgcggccggtgccgccgtgaccctggtctcc
gggcccgtggcgctccccgatccgccgggcgtcgccgtcgtccgggtcgagaccgcccgg
cagatgctggaagccgtcgaggcggcgctgccggccgacatcgcggtcttcgccgccgcg
gtcgccgactggcgtccggagcaggaggccggcagcaagaagatcaagaaggacggtacc
ggcccggcgccgatgccgctggtggagaatcccgacatcctcgccacgatcgcccgcctg
ccggtggggcgcccgcccctcgtggtcgggttcgccgccgagaccgacacggtcgtcgag
cacgcccgggcgaagattgcccggaagggctgcgacctgatcgtggccaacgacgtgtcg
gccgagggcggcgtcatgggcggcgccgacaacacggttcacctgatccgacgggacggt
gcggtggaaacctggccgcgcctcggcaaggaggaagtcgcccggcggctcgtggcccat
gtcgcggggcttctggccggctga

DBGET integrated database retrieval system