KEGG   Metakosakonia sp. MRY16-398: MRY16398_10190Help
Entry
MRY16398_10190    CDS       T05735                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
mety  Metakosakonia sp. MRY16-398
Brite
KEGG Orthology (KO) [BR:mety00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mety03016]
    MRY16398_10190 (truC)
Enzymes [BR:mety01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     MRY16398_10190 (truC)
Transfer RNA biogenesis [BR:mety03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    MRY16398_10190 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 MHYT
Motif
Other DBs
NCBI-ProteinID: BBE75963
UniProt: A0A348D8Z6
Position
1080366..1081148
Genome map
AA seq 260 aa AA seqDB search
MLEIIYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMDEAVLDYPLVEELDKIADKFAREDK
GPQPAVTHYRGMAATEMPVATSKFPTTRYGLVELLPQTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFGCNRLMLHASQLTLTHPFTGEPLTLHAGLDDVWMRALSQFGWQGLL
PDNERVEFVSPCGQDGGIHI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagattatctatcaggacgaatggctggttgcggtgaataaaccctcaggctgg
ttggtacatcgaagctggcttgatcgggatgaaaaagtggtggtgatgcaaaccgtccgc
gaccagataggccagcatgtctttactgcgcatcgtctcgacagaccaacctccggtgta
ttgctgatggggctgtcgagcgaggcggggcgtcttctggcgcagcaatttgagcagcac
caaattcagaagcgctaccatgcgatcgtgcgcggctggctgatggacgaggcggtgctg
gattatccgctggttgaagagctggataaaatcgcggacaaatttgcccgggaagataaa
ggccctcagccagcggtgacgcattatcgcgggatggcggcgaccgaaatgccggtggcg
accagtaaatttccgaccacacgttacggcctggtggaactgctcccacaaaccgggcgt
aagcatcagctccgtcgccatctcgcccatttacgccatccgattatcggcgacagcaaa
cacggtgatttgcgtcagaaccgcagtgcggcagaacattttggctgtaaccgactgatg
ctccatgccagtcagttaacgctcactcacccctttaccggcgaaccgctgacgctgcat
gccgggctggatgatgtctggatgcgggcgttgtcgcagtttggctggcaggggcttctc
cctgacaatgaaagggttgagtttgtctcgccgtgcggtcaggatggcgggattcacatt
taa

DBGET integrated database retrieval system