KEGG   Metakosakonia sp. MRY16-398: MRY16398_22320Help
Entry
MRY16398_22320    CDS       T05735                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00561  Glycerolipid metabolism
mety00640  Propanoate metabolism
mety01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MRY16398_22320
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MRY16398_22320
Enzymes [BR:mety01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     MRY16398_22320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Ldh_1_C AIRC DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: BBE77176
UniProt: A0A348DCF9
Position
2350612..2351697
Genome map
AA seq 361 aa AA seqDB search
MQALNIIFPAQILRGAGVINRLGGVCAALGKRALVIGGHAGLAAVDTQIRHQLAASAVDL
VGMEWFGGVCSEENIQRLAHQVEVTGADLVIGVGGGKALDTSKAVAVQTHVPVVTIPTIA
ATCAAVTPLTIRYHANGHFRDLFPLAQAPAAVIIDSEILATAPLRWLAAGLGDTLAKWYE
FRAISVRHQNHSGVAQASSANSRICYDLIKAHGPAACDAVRAGKPNAALEQVLDAIFMFA
GLTSLMSSGAHAAAAHAIYEGFTVCDKTREFGHGLLVGFGNLCLLALENRSDDELLEAVR
LAHACAVPLRLSDIAALDTGELEQIVQMSLHAPDMKNMPDNVTAQALYQAIARVEAMAEQ
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcactgaatattatcttcccggcgcaaattttacgtggcgcaggcgttatcaac
cgccttggcggagtgtgcgccgcgttgggcaaacgcgccctggtcattggcgggcatgcc
gggctggcagcggtggacacacagattcgccatcaactggcggcctctgcggtcgacctg
gtgggcatggagtggtttggcggcgtgtgcagcgaagagaatatccagcgcctggcccac
caggtcgaggtgacaggggcggatctggtgataggcgtcggcggcggcaaagcacttgat
accagtaaagccgttgcggtacagacgcatgtgccggttgttaccattcccaccatcgca
gcgacctgtgcggccgtgacgccattgaccattcgttatcacgccaatggccattttcgc
gatcttttccccttagcgcaggcgcccgctgcggttattatcgacagcgaaattctggcc
accgcgccgctgcgctggctggcggcgggccttggcgacacgctggcaaaatggtacgaa
ttccgtgcgatcagtgtgcggcatcagaaccacagcggcgtcgcgcaggcttccagcgcc
aacagccgtatctgttatgaccttattaaggcccacggacctgccgcctgcgacgccgtg
cgggcaggcaaacccaacgccgcgctggaacaggtgctggatgccatatttatgtttgcc
ggactgacatcgctgatgagcagcggtgcgcatgccgccgccgcccatgcgatttatgaa
ggctttacggtctgtgataaaacccgcgaatttggtcatgggctcctggtgggctttggc
aatctgtgtctgctggcgctggaaaatcgtagtgatgacgaattacttgaggcggtacgt
ctggcgcatgcctgcgcggtaccgctgcgcctgagtgatattgccgcgcttgataccggt
gagcttgagcagattgtgcaaatgtcattgcatgccccggatatgaaaaatatgccagat
aacgttaccgcacaggcgctctaccaggcgattgcgcgcgtcgaagcgatggcagagcaa
ctctga

DBGET integrated database retrieval system