KEGG   Metakosakonia sp. MRY16-398: MRY16398_23110Help
Entry
MRY16398_23110    CDS       T05735                                 

Gene name
btuE
Definition
(GenBank) thioredoxin/glutathione peroxidase BtuE
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00480  Glutathione metabolism
mety00590  Arachidonic acid metabolism
mety01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MRY16398_23110 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MRY16398_23110 (btuE)
Enzymes [BR:mety01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MRY16398_23110 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA PKD_3
Motif
Other DBs
NCBI-ProteinID: BBE77255
UniProt: A0A348DCN8
Position
2421544..2422095
Genome map
AA seq 183 aa AA seqDB search
MHQDILNTEITTIDGEHITLEKYQGKVILVVNVASKCGLTPQYEQLENIQKAWEKDGFIV
LGFPCNQFAGQEPGNEEEIKTFCSTTYGVTFPMAAKVDVNGENRHPLYRKLIAAAPKAVA
PEGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPILMEAIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaggatattttgaacaccgagattacaacaattgatggcgaacatatcacgctg
gaaaaataccagggcaaggttattctggtggtgaatgtggcctcaaaatgtggcctgacg
ccacagtatgaacaactggaaaacattcagaaagcctgggagaaagacgggtttatcgtt
ctcggcttcccgtgtaatcagtttgccgggcaggagccgggcaatgaagaagagatcaaa
accttctgcagcacgacctatggggtgactttcccaatggcagccaaagtcgatgttaac
ggtgaaaatcgccatcctttgtatcgcaaattgattgccgcggcaccaaaggctgtcgcc
ccggagggcagcggtttttatgagcgcatggccagcaaagggcgggcaccgctttatccg
gatgatatcctgtggaactttgaaaaattcctgattggtcgtgatggtcaggttgttcag
cgtttctcaccggatatgacacccgaagatcctatcctgatggaagcgattaagctggcg
ctggcaaaataa

DBGET integrated database retrieval system