KEGG   Metakosakonia sp. MRY16-398: MRY16398_34680Help
Entry
MRY16398_34680    CDS       T05735                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
mety  Metakosakonia sp. MRY16-398
Brite
KEGG Orthology (KO) [BR:mety00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mety03009]
    MRY16398_34680
Enzymes [BR:mety01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     MRY16398_34680
Ribosome biogenesis [BR:mety03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MRY16398_34680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_12 Methyltransf_32 MTS PCMT MetW Methyltransf_29 Methyltransf_9 NodS CMAS Methyltransf_4 PrmA
Motif
Other DBs
NCBI-ProteinID: BBE78412
UniProt: A0A348DFZ5
Position
complement(3604521..3605336)
Genome map
AA seq 271 aa AA seqDB search
MPFSCPLCHAPLTRSEHSFSCPQRHQFDIAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIALQLQTRLPAQAEAILDIGCGEGYYTQSFAEVAQRKEARTFGLDVS
KAAIRAAAKRYPEVMFCVASSHRLPFQNDSIDAVVRIYAPCKAEELVRVVKPGGWVITAA
PGPRHLMELKELIYREVQLHAPDNGEIEGFRVVEQQSLSYQMELTGAEAVALLQMTPFAW
RAKPDVRETLAAKARFNCQTDFTLHCLQRVD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcagttgcccactttgtcacgcccccttgacgcgttccgaacatagcttttcc
tgtccacaacgtcatcagttcgacatcgcgaaagaagggtacgtcaacttactgcccgtg
cagcataagcgttcgcgggatccgggtgacagtgcggaaatgatgcaggcgcgccgtgcg
tttcttgatgccggacactaccagccgctgcgcgatgcgatcgctttacagttacagacg
cgcctccctgcgcaggcagaggcgatactggatattggctgtggggaagggtactacact
cagtcctttgctgaggtcgcgcagcgtaaagaggcccggacgtttggcctcgatgtttca
aaagccgccattcgggcagccgcgaaacgttaccctgaggtgatgttttgcgttgcctcc
agccatcgcctgcctttccagaatgacagcattgacgctgtcgtacgcatttacgcaccc
tgcaaagcagaagaactggtacgtgtggtaaaaccggggggatgggtcattaccgcagcg
cctgggccacgccacttgatggagctgaaagagttaatttaccgcgaagtacagttacat
gcgcctgataatggcgagatagaagggtttcgcgtcgtagagcagcaatcactgagctat
cagatggaattaaccggtgccgaggccgtcgcgttactgcaaatgacgccctttgcgtgg
cgggcaaaaccggatgtccgggagacactggcagcgaaagcgcgctttaactgtcagacc
gattttaccctgcattgtctgcagcgcgttgattaa

DBGET integrated database retrieval system