KEGG   Metakosakonia sp. MRY16-398: MRY16398_36440Help
Entry
MRY16398_36440    CDS       T05735                                 

Gene name
putA
Definition
(GenBank) bifunctional protein PutA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00250  Alanine, aspartate and glutamate metabolism
mety00330  Arginine and proline metabolism
mety01100  Metabolic pathways
mety01110  Biosynthesis of secondary metabolites
mety01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MRY16398_36440 (putA)
   00330 Arginine and proline metabolism
    MRY16398_36440 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mety03000]
    MRY16398_36440 (putA)
Enzymes [BR:mety01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     MRY16398_36440 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     MRY16398_36440 (putA)
Transcription factors [BR:mety03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    MRY16398_36440 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH RHH_1
Motif
Other DBs
NCBI-ProteinID: BBE78588
UniProt: A0A348DGH1
Position
3771366..3775328
Genome map
AA seq 1320 aa AA seqDB search
MGTTTMGVKLDDATRERLKAAAASIDRTPHWLIKQAIFSYLEKLENNEIIPELPATHAGQ
YAESDEADSSADESAQPFLEFAENILPQSVSRAAITAAWRRPETDAVPMLLEQARLAPPI
AENTQQLASQLAAKLRNQKTASGRAGMVQSLLQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISNGNWQSHIGRSASLFVNAATWGLLFTGKLVSTHNEASLSHSLNRIIGKSG
EPLIRKGVDMAMRLMGEQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAEAY
MVSYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYNRAQYDRMMDELYPRLKSLALLA
CQYDIGINIDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPFVIDYLTDL
ASRSRRRLMIRLVKGAYWDSEIKRAQMEGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLI
YPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVVGKISDGKLNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADTSLPLDELVADPVLAVEKLATQEGHVGL
PHPKIPLPRWLYGQGRINSAGLDLANEHRLASLSSSLLNSTTQKWQAKPLLETPVAEGEM
EPVLNPAEPKDVVGYVREASGSEVARALESAVNNAPIWFATPPQERAAILERAAVLMEDQ
MQTLLGILVREAGKTFSNAIAEVREAVDFLRYYAGQVREDFANETHRPLGPVVCISPWNF
PLAIFTGQIAAALAAGNTVLAKPAEQTPLIAAQGVAILREAGVPSGVLQLLPGRGETVGA
QLTSDNRVRGVMFTGSTEVASLLQRNIATRLDAQGRPTPLIAETGGLNAMIVDSSALTEQ
VVVDVLASAFDSAGQRCSALRVLCLQEEIAEHTLTMLRGAMAECRMGNPGRLTTDIGPVI
DREAKENIEKHIQAMREKGRPVFQTAHENTLDAREWRTGTFVMPTLIELESVDELKKEVF
GPVLHVVRYRRNDLDKLVSQINAAGYGLTLGVHTRIDETISQVTGSAHVGNLYVNRNMVG
AVVGVQPFGGEGLSGTGPKAGGPLYLYRLLASRPETAIKQTLSRHDTRFPLDAQLKPSLI
QPLDALTHWAEDKPALQAICQRFGELAQTGIQRVLPGPTGERNTWTLLPRESVLCMADNA
EDSLTQLAAALASGCRVLWPDDELHRTLHNALPESVSARITLAALDNLLSQPFDAVIYHG
DSDQLRELCGHIATRDGAIISVQGFARGESNILLERLWLERSLSINTAAAGGNASLMTIG
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgggtaccaccaccatgggcgttaaacttgatgatgcgacgcgtgagcgactgaaagcc
gctgctgcatcgattgaccgcacaccacactggctgattaagcaggccatctttagctac
ctggaaaaactcgaaaataacgaaataattccagaattgcctgcgacccatgcgggtcag
tacgccgaaagcgatgaagccgatagcagcgctgatgaaagtgcccagcctttcctcgaa
ttcgccgaaaacattttgccgcagtcggtttcacgtgccgctatcaccgccgcctggcgt
cgcccggaaacggatgcggttcccatgctgcttgagcaggcgcgtcttgcgccgcctatt
gccgaaaatacccagcagttagccagccaactggcggcgaagctgcgtaaccaaaagacc
gcgtccggccgggcgggtatggtacagagtttgttgcaagaattttcactttcttcgcaa
gaaggggtggcgctgatgtgcctggcagaggcgctgttgcgcattcctgataaggccacc
cgcgatgcgctgatccgcgacaaaatcagcaatggtaactggcaatcgcatattggccgc
agcgcctcgctgttcgtcaatgccgccacctggggcctgctctttaccggcaaactggtc
tctacccacaacgaagccagcctgtcgcactcgcttaaccgcattatcggcaagagcggc
gaaccgctgatccgcaaaggggtggacatggcgatgcgcctgatgggcgagcagttcgtc
accggggaaaccattgccgaagcgctggctaacgcccgcaaactggaagaaaaagggttc
cgctactcctacgatatgctgggtgaggccgcgctgaccgctgccgatgcagaggcctac
atggtctcttaccagcaggcgatccacgcgattgggaaagcctctaatggccgcggcatt
tatgaagggccggggatctccattaagctctctgcgctgcacccacgctacaaccgcgcc
cagtacgacagaatgatggacgagctctacccgcgcctgaaatcactggcgctgcttgcc
tgccagtatgacatcggcatcaatatcgacgccgaagaggccgaccggctggaaatctct
ctcgatctgctggaaaagctctgtttcgaaccagaactggcgggctggaacggcatcggt
tttgtgattcaggcctaccagaaacgctgtccgttcgtcattgattacctgacggatctg
gcctcacgtagtcgccgtcgtctgatgatccgtctggtgaaaggcgcgtactgggatagc
gagatcaaacgcgcgcagatggaagggctggaggggtatccggtctatacgcgcaaagtc
tataccgacgtctcctacctggcctgcgcgaaaaaattgctcgccgtgccgaatttgatt
tacccgcagttcgccacccacaacgcccatactctggccgctatctatcaactggcgggg
caaaactactatccgggtcaatacgagttccagtgtctgcacggcatgggcgagccgctc
tacgagcaggtggtcggtaaaatctctgacggcaagctgaaccgcccttgccgcatctac
gctccggtgggcacccacgaaaccttgctggcttatctggtgcgtcgcctgctggaaaac
ggcgccaatacctcctttgtgaaccgtattgccgatacatcgctgccgctcgatgaactg
gtggccgacccggtgctggcggtagagaaactggcgacacaagaaggccatgttggcctg
ccgcatccgaaaatcccgctgccacgctggctgtacggacaggggcgtatcaactcagca
gggctggatctggccaatgaacatcgactggcctccctctcctcttccctgctcaacagc
acgacacagaaatggcaggccaaaccgttactggaaaccccggtagcggaaggtgaaatg
gagcccgtgctcaacccggcagagccgaaagatgttgttggctatgttcgggaagcctcc
ggcagtgaagtggcgcgcgcgctggaaagtgcggtgaataacgcgcctatctggtttgcc
accccgccccaggagcgcgcggcgatcctcgaacgtgcggcggtactgatggaagatcag
atgcagacactgctcggcatcctggtacgcgaagcaggcaaaacattcagcaatgcgatt
gccgaagtccgtgaagcggtcgatttcctgcgctattacgcaggccaggtacgggaagat
tttgctaacgaaacccaccgcccgctgggtccggtggtctgtatcagcccgtggaacttc
ccactggcgattttcaccgggcaaatcgcggcggcgctggcggccggtaacaccgtgctg
gcaaaaccggcagagcagacaccgctgattgccgcacagggtgtcgctattctgcgggaa
gcgggcgtcccgtcgggcgtgctgcaactgctaccaggccggggcgaaaccgtaggcgcg
cagttgacgtcagataaccgcgtacgcggcgtgatgttcaccggttctacggaagtggca
agcctgttacagcgcaatattgccacaagactggatgcacaagggcgtccgacgccgctt
atcgccgaaacaggcgggctgaatgcaatgattgtcgactcttctgcgttgaccgagcag
gtggtggtcgatgtgctcgcctcggcctttgatagcgccggacagcgctgttcggcactg
cgcgtactctgcctgcaggaagagattgccgaacataccctcaccatgctgcgcggcgcg
atggcggaatgtcgcatggggaatccaggacgcctgacaacggatatcggtccggtgatt
gaccgcgaagccaaagagaatattgagaaacatattcaggcaatgcgcgagaaaggtcgc
ccggtgttccagacggcccatgaaaacacccttgatgcccgtgaatggcgaaccggcacc
tttgtaatgccaacgctcattgagctggagagtgtggacgagctgaaaaaagaggtcttt
ggtccggtgctgcacgtggtgcgctaccgccgcaacgatctcgacaaactggtaagtcag
attaatgccgcaggttatggcctgacgctgggtgttcacacccgcattgatgagactatc
tctcaggtgaccggcagcgcgcatgttggcaacctgtacgtaaaccgcaacatggtcggc
gcggtcgtgggtgtacagcccttcggcggagaggggctatctggcaccgggcctaaagct
ggcggaccgctgtacctttatcgcctgctcgccagccgcccggaaacggccatcaagcag
acgctgtcgcgtcacgatacccgcttcccgcttgatgcacagcttaaaccgagcctgatc
cagccgctggatgcgctgacacattgggcagaggataaaccggcattgcaggctatttgc
cagcggtttggcgaactggcccagaccgggatccagcgggtactccccggccctaccggt
gaacgcaatacctggacgctgctgccccgcgagtcggttctttgcatggccgacaacgca
gaagatagcctgacacagcttgcggcagccctcgccagcggctgtcgggtattgtggcca
gatgatgagcttcaccgcaccctgcataacgcgttaccagagagtgtcagcgcaaggatc
acgctggccgcgctcgataacctgctttcacagccatttgatgcggttatctatcacggt
gactccgatcagctacgtgaactgtgcggacatatcgcgacgcgcgatggcgccatcatc
tcggtacagggttttgcccgtggtgagagcaacattttgctggagcgtttatggctggag
cgttcgctgagtatcaacaccgcggccgcaggcggcaatgccagcctgatgaccatcggc
taa

DBGET integrated database retrieval system