KEGG   Methanothermobacter sp. MT-2: METMT2_0673Help
Entry
METMT2_0673       CDS       T05694                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
metz  Methanothermobacter sp. MT-2
Pathway
metz00860  Porphyrin and chlorophyll metabolism
metz01100  Metabolic pathways
metz01110  Biosynthesis of secondary metabolites
metz01120  Microbial metabolism in diverse environments
Module
metz_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:metz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    METMT2_0673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:metz01007]
    METMT2_0673
Enzymes [BR:metz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     METMT2_0673
Amino acid related enzymes [BR:metz01007]
 Aminotransferase (transaminase)
  Class III
   METMT2_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAW31375
UniProt: A0A3G9CZE2
Position
651157..652416
Genome map
AA seq 419 aa AA seqDB search
MISKDLFKEALEVLPGGVSSPVRRFEPYPFFAEKGEGCMLYDMDGNRYIDYCLAYGPLIL
GHAPANVTSAVCEQIKKGSTYGTPTKAEVELAKLVIERVASVEMVRFVNSGTEATMAAIR
LARAFTGKDKIIKFEGAYHGAHDYVLVKPGSGAVSAPDSPGIPPETTKNTISAPFNDEES
ITRIIEKDDNIAAILVEPVMANIGCIEPEDGYLKFLRKITSENDMLLIFDEVITGFRLAP
GGAQEYYNIKADLVTYGKIIGGGFPMGALAGPRELMENISPAGDVYQAGTFNGNPVSVTA
GISMLNALTDTLYRELNRKGEMIRGGIRDILEDNRLELHLAGLSSMFQVYFTQREVKSYA
DAKTADIEAFKKYFHGLLEGGVFIPPSQFECCFISAAHEIEDLETTLEVMEESIKGTVK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaaaggatttgtttaaagaagctttagaagttcttccgggtggtgtgagctct
ccagtaagaagatttgaaccatatccttttttcgccgaaaaaggtgaaggttgcatgctc
tatgacatggatggtaatcgttacatagactattgtttagcctacggccccctaatactt
ggacatgccccagcaaatgttacaagtgcagtttgtgaacaaatcaaaaaggggagtaca
tatggtactccaaccaaagccgaggttgaacttgcaaaacttgtcatagaaagagtagca
tctgttgaaatggtaagatttgtaaattctggtactgaggctacaatggccgctataaga
cttgcaagggcgttcacaggaaaggataaaataattaaattcgagggcgcgtatcatggc
gcacatgattatgtcctggtaaaacctggatctggcgcggtatcagcccctgattcacca
ggcatacccccagaaacgacaaaaaatactatatcagcaccctttaatgatgaagaatca
attaccaggataatagaaaaggacgacaacattgcagccatcctagtagaacctgtgatg
gcgaatataggttgtatagaaccagaagacggctacctaaaattcttgaggaaaataacc
agtgaaaatgatatgcttttaatatttgatgaggttatcacaggtttcaggttggctcct
gggggtgcccaggaatattataatataaaagcagaccttgtaacctatgggaagattata
ggtggcgggttcccaatgggcgccctagcaggtccaagagaattaatggagaacatatca
cctgcaggtgacgtttatcaggccggaacattcaatggcaaccctgtatcagtaactgct
ggtataagtatgcttaatgcgctgacagacaccctttacagggaactgaacagaaaaggg
gaaatgataagaggcggtataagagatattctagaggataacaggttagaacttcacctg
gcaggactatcttcaatgttccaggtttactttacccaaagggaagttaaaagttatgct
gatgcgaaaacagctgacatagaagctttcaaaaaatatttccatggactgctagagggt
ggggtgttcataccaccttcacaatttgaatgctgttttatttcagcagcccatgaaata
gaagatcttgagacaacattagaggtgatggaggaatccattaaagggactgttaagtaa

DBGET integrated database retrieval system