KEGG   Methanothermobacter sp. MT-2: METMT2_1391Help
Entry
METMT2_1391       CDS       T05694                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
metz  Methanothermobacter sp. MT-2
Pathway
metz00220  Arginine biosynthesis
metz01100  Metabolic pathways
metz01110  Biosynthesis of secondary metabolites
metz01130  Biosynthesis of antibiotics
metz01230  Biosynthesis of amino acids
Module
metz_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:metz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    METMT2_1391
Enzymes [BR:metz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     METMT2_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: BAW32093
UniProt: A0A3G9D0U7
Position
complement(1313938..1314837)
Genome map
AA seq 299 aa AA seqDB search
MRHLLSVCDMEDKIEYLLDLADKFKKGQIKEKPLKDKYMAMVFEKASTRTRISFEVGMSQ
LGGTPLYLSAQDLQLGRGEPIADTARTLSRYVDAIMIRAFRHQDVVELAENATIPVINGL
TDLEHPCQALADMQTIKEYKGGFNCKLAFVGDGNNVCNSLILISAMVGMKISVASPRGYE
PNTKIIKKAKKIARDKSLIKITQDPYKAVDGADIVYTDVWVSMGNENETEKRLKAFKPYQ
VNKNLMDHAKKDAIFMHCLPAKRGQETTSEVIDGPHSVVWDQAENRLHAQKAIMYWLIK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagacacctattatcagtatgtgacatggaagacaaaatagaatacctcctagacctg
gcagataaattcaaaaagggccagataaaagaaaagccactaaaagacaaatacatggca
atggtgttcgaaaaagcctcaacaagaacaagaatatcattcgaagtgggaatgagccaa
ctcggaggaacacccctctatttgtcagcgcaggacctccaactaggaagaggcgagccc
atcgcagacacggcacgaaccctaagcagatacgtggacgccataatgataagagcattc
agacaccaggacgttgttgaattagcagaaaacgcaacaataccagtaattaacggatta
acagaccttgaacatccatgccaagcccttgcagacatgcaaaccataaaagaatataaa
ggaggcttcaactgcaaattggcatttgtaggtgatggtaacaacgtttgcaactcccta
atcctaatatcagccatggttggaatgaaaatttccgtcgcatcccccagaggctatgaa
ccaaatacaaaaataatcaaaaaagccaagaaaatagctcgggacaaatccctgataaaa
ataacccaggacccatacaaagccgttgatggagccgacatagtctatactgatgtatgg
gttagcatgggaaatgaaaatgaaacagaaaaaagattaaaagccttcaaaccataccag
gtgaacaagaatttaatggaccatgccaaaaaagatgccatattcatgcactgtttaccc
gcgaaaaggggccaggagacaacatctgaagtgattgacggcccacattcagtggtgtgg
gatcaggcggaaaatagactccatgcacagaaggctatcatgtactggctaataaaatag

DBGET integrated database retrieval system