KEGG   Methylophilus sp. TWE2: ACJ67_09545Help
Entry
ACJ67_09545       CDS       T04002                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
meu  Methylophilus sp. TWE2
Brite
KEGG Orthology (KO) [BR:meu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACJ67_09545
Enzymes [BR:meu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     ACJ67_09545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AKR43643
UniProt: A0A0K0SWG1
Position
2003475..2004332
Genome map
AA seq 285 aa AA seqDB search
MAEKKTKKLKSTASDDIVKVAAVQMASSPNVSANLVEAKRLIEMAAKAGAKLVVLPEYFC
IMGLKDVDKVAIREKQNEGPIQQFLSKTAKAYKIWIVAGSVPLESQHANKVRNSCLVYND
KGEQVARYDKIHLFGLDMGTEHYHEENTIEPGDTVVTLDTPFGRIGLSICYDLRFPELYR
AMGEVDMIVVPSAFTETTGKAHWETLIRARAIENLTYVIASAQGGYHLSGRETHGNSMIV
DPWGVVLDRLPRGSGIVIANVNRNYIKNLRQSLPALKHKTIKAIS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagaaaaccaaaaaactgaaatctacagccagtgatgacatcgttaaagtc
gccgccgttcaaatggcatccagccccaacgtatcagccaacctggtagaagccaagcgg
ttgatcgaaatggctgccaaggcaggcgcaaaactggtcgtgctcccggaatacttctgc
attatggggctgaaggatgtggacaaggtcgctatccgtgaaaagcagaatgagggcccc
atccaacagtttttgagcaagacagccaaggcctacaaaatctggatagtggctggctct
gtcccactggaaagccagcacgcaaacaaggtccgcaatagctgcctggtttacaacgat
aagggcgagcaagtggctcgttatgacaaaatccacctgttcggtttggacatgggcacg
gaacactaccatgaagaaaacaccatagagcctggggacaccgtagtgaccctggatacg
ccttttggtcgtattggcttgtctatttgctatgacttacgtttccctgagctgtatcgc
gccatgggcgaagtcgacatgatcgtcgtgccatccgcctttaccgaaaccacaggcaag
gctcactgggaaacactcatccgcgcccgcgcgatagaaaacctgacctatgtcatcgct
tcggcacaaggtggttaccacttatccggccgcgaaacacatggtaatagcatgattgtt
gacccttggggcgtagtactggaccggctgccacgtggctcagggattgtgattgccaat
gttaaccgcaattatattaaaaacctgcgccagagcctgcccgccttgaaacacaaaacc
attaaggcaatttcatga

DBGET integrated database retrieval system