KEGG   Methanohalobium evestigatum: Metev_0128Help
Entry
Metev_0128        CDS       T01261                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00010  Glycolysis / Gluconeogenesis
mev00030  Pentose phosphate pathway
mev00051  Fructose and mannose metabolism
mev00052  Galactose metabolism
mev00230  Purine metabolism
mev00500  Starch and sucrose metabolism
mev00520  Amino sugar and nucleotide sugar metabolism
mev00521  Streptomycin biosynthesis
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01120  Microbial metabolism in diverse environments
mev01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_0128
   00030 Pentose phosphate pathway
    Metev_0128
   00051 Fructose and mannose metabolism
    Metev_0128
   00052 Galactose metabolism
    Metev_0128
   00500 Starch and sucrose metabolism
    Metev_0128
   00520 Amino sugar and nucleotide sugar metabolism
    Metev_0128
  Nucleotide metabolism
   00230 Purine metabolism
    Metev_0128
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metev_0128
Enzymes [BR:mev01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Metev_0128
    5.4.2.8  phosphomannomutase
     Metev_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV GidB Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: ADI73059
UniProt: D7E637
Position
complement(128003..129352)
Genome map
AA seq 449 aa AA seqDB search
MGLFGTNGVRGIANEEITPELAVDIAKSLGTYLGNNATVAIGRDTRVSGNMIKYAAISGS
LSSGLSVIDVDMVPTPSIQYYIKNTRTDAGIIITASHNPREYNGIKLIDGDGTEFSREGE
KEVENIYYSKQYNNAGWENTGNLQTDHNVNDYYIKGIINSVDAEKIQKQNFKVVVDTGCG
AGSLTLPFLLRKLGCEVITINAQIDGTFPWRNPEPTPDVLEELSEIIRLSGADMGVAQDG
DADRAVFTDENGNFVDEEVLLSLVAKNILNQKKGPIVTPVSSSQRMADVAKEAGVELIWT
AVGSINVARKMMEMNAVFGGEGNGGLIFPEHQYCRDGAMSCAKLLEIMASGTPLSKLAED
VPEYYNSKTKIPCNNLEHTMECIKKKVHEDNVGIKIDTIDGVKVWFEDGWVLVRPSGTEP
IIRVYAESKTMSRAEKLMENGALWIKNCE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggattatttggaactaatggagtcaggggtatagccaacgaagaaatcacacctgaa
cttgctgttgatattgctaaaagtcttggtacttatttgggcaataatgctactgtagcc
ataggaagggacacaagggtttcaggaaacatgatcaaatatgctgctatatcaggttct
ctttcttcaggactatcagttattgatgtcgatatggtacctacaccatctatacagtac
tacataaaaaataccagaactgatgcaggtataattattactgcatcccataatcctcga
gaatataacgggattaaattgatagatggtgatggaactgaattttctcgagaaggggaa
aaagaagtggaaaatatctattattcaaaacaatataataatgcaggatgggaaaataca
ggtaatttgcagacagatcataatgttaacgattattacataaaaggtatcattaattca
gtagatgcggaaaaaatccaaaagcagaatttcaaggttgtagtggatacaggatgtggt
gcaggttcactcactctcccctttttgctcagaaaactgggttgtgaagtgataacaatc
aatgcccagattgatggcacattcccatggagaaatcctgaacctactccagacgtattg
gaagaactttcagaaattatacgcctcagcggtgctgatatgggcgtcgcacaggatggt
gatgcagatcgcgctgtgtttacagatgaaaacgggaactttgtagatgaagaagtactg
ctttcattggtggctaagaatatattgaaccagaaaaaaggaccaattgtaacccctgta
agctcttcccagcgtatggctgatgttgcaaaggaagcaggtgttgaacttatctggact
gctgtaggttccataaatgtagcccggaaaatgatggagatgaacgctgtatttggtgga
gaaggtaatggtgggctaatattcccagaacatcaatactgcagggacggtgcaatgtca
tgtgcaaagctacttgaaataatggcatcaggtacaccactgtcaaagcttgctgaagat
gttcctgaatattataattccaaaacaaagataccctgcaataatctggaacacaccatg
gaatgtataaagaaaaaggtacatgaagataatgtaggtatcaaaattgatacaatagat
ggtgtcaaagtatggtttgaagatggatgggttcttgtaagaccatcaggaacagaacca
ataataagagtatacgctgaatcaaaaacaatgagcagagcagaaaaacttatggaaaac
ggtgctctttggattaaaaattgtgaataa

DBGET integrated database retrieval system