KEGG   Methanohalobium evestigatum: Metev_0181Help
Entry
Metev_0181        CDS       T01261                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00260  Glycine, serine and threonine metabolism
mev00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01130  Biosynthesis of antibiotics
mev01230  Biosynthesis of amino acids
Module
mev_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_0181
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0181
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metev_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADI73112
UniProt: D7E690
Position
complement(185857..187161)
Genome map
AA seq 434 aa AA seqDB search
MEQTKILLDENEMPKQWYNILPDLPTPVEPPLNPETKEPIKPEELESIFPKSLIEQEMSS
DNYIDIPEEIRDIYKLWRPSPLHRAHRLEELLDTPAKIYYKNEGVSPAGSHKPNTSIAQV
YYNMKEGNERVTTETGAGQWGSALSLACNYFDLECKVYMVRSSFEQKPFRKSLINLWGAT
VIPSPSKETKFGQQFLEQYPDTTGSLGIAISEAIEDASENDNTKYALGSVLNHVMLHQTV
IGLESQKQLEKVDEYPDIVIGCCGGGSNLAGISFPYIKDKINKKHDPEIIGVEPSACPTL
TEGSFKYDSGDTAMMTPLLKMYTLGHDFVPPSIHSGGLRYHGCSPIISRLYDDGLMKGRN
YHQVEIFDSAVKFARTEGIVPAPESSHAIKCAMDEATKCRETGEEKTILFNLSGHGHFDM
SAYDKYFNKKLGNE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacaaaaattttacttgatgaaaatgaaatgccaaagcagtggtacaatata
ttgccagatcttcctactcctgttgaaccaccacttaaccctgaaacaaaagaaccaata
aaaccagaagaactggaatcaatatttccaaaatcattaattgagcaggagatgtcttct
gacaattatatagatattcctgaagaaattcgcgatatctacaagttatggagaccttca
ccacttcaccgcgcccatagacttgaagaattgctggatacccctgcaaaaatctattac
aaaaatgaaggagtaagccctgcaggcagtcacaaacccaacacctcgattgcacaggta
tactacaacatgaaagaaggtaatgaaagggtaactaccgaaaccggtgcaggacaatgg
ggtagtgcactatcacttgcctgcaactattttgacttggaatgtaaggtttacatggta
cgctccagttttgaacaaaaacccttcagaaaatccttaatcaacctctggggagccact
gttattccatcacccagtaaagaaactaaatttggacaacaattcctcgaacaatatcct
gacacaacaggaagtcttggcattgccatcagtgaagccattgaagatgcatcagagaac
gataatacaaaatacgctcttggaagtgttttaaatcacgtaatgctacaccaaacagtt
ataggtcttgaatcacagaaacagttagaaaaagttgatgaatacccagatattgtcata
ggatgttgtggcggaggcagtaaccttgcgggaatcagttttccgtatataaaggataag
ataaacaaaaaacatgacccagaaataataggtgttgaaccatctgcctgccccactctt
acagaagggagctttaaatacgattcaggagatactgcaatgatgactccactgcttaaa
atgtacacactggggcatgattttgtacccccgtccattcactcggggggacttaggtat
catggatgttcaccaataataagcagattatatgacgacggattgatgaaaggcagaaac
taccaccaggttgagatttttgattctgctgttaaatttgccagaaccgaaggtattgtg
ccagcacctgaatcatctcatgccataaaatgtgcgatggatgaagcaacaaaatgcaga
gaaaccggtgaagaaaaaaccattcttttcaatctaagtggacacggacactttgatatg
tcagcttatgataaatattttaacaaaaaactgggcaacgaataa

DBGET integrated database retrieval system