KEGG   Methanohalobium evestigatum: Metev_0304Help
Entry
Metev_0304        CDS       T01261                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00860  Porphyrin and chlorophyll metabolism
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01120  Microbial metabolism in diverse environments
Module
mev_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metev_0304
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metev_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADI73231
UniProt: D7E6K9
Position
292561..293388
Genome map
AA seq 275 aa AA seqDB search
MTSNINQDTGQTPVIAIMRPEMYLNKSVILAQEYGFETFSAPMIEIVDKKDACFDDFVYR
VLNGKSDYVIFTSANGIDFTLNKISDEIKQEFLVALNNTNVLAIGPNTQKALEDTGIECI
DLPDSYSSEGVVDYLSLYVEGKTIDIARSSHGSKYLISGLINNGATVFETQVYTLNTPDN
ITQKNLIRCALAGNISVFAFTSSMIVHNFFTKANDVEAEDRIIEILNSNDTTVAAIGTPT
ASTLKNYGVKVDIVPEKYLFENMLADIHDFIYGTQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaatataaatcaagatactggtcaaacaccagttatagccatcatgcgtccg
gaaatgtatcttaacaaatcagtaatattggcacaggagtatggttttgagaccttttct
gcacccatgattgaaattgtagataaaaaagatgcctgtttcgatgattttgtataccgg
gtgttaaacggtaaatccgattatgtaatctttaccagtgcaaatggtatcgattttaca
ctaaacaaaatttctgatgaaatcaagcaggaatttttggtagctttgaacaataccaat
gtattggcaataggtccaaacacacagaaagctcttgaagatactggtatagaatgtata
gatttgcctgattcatatagttccgagggtgttgtggattacctcagcctttatgtagaa
ggtaaaacgattgatatagccagaagttcacatggttcaaaatatttgatatctggtctc
attaacaacggagcaacggtatttgaaacccaggtttatacactgaataccccggacaac
atcacacagaaaaaccttatacgttgtgcactcgcgggaaacatatccgtgtttgcattt
acaagttctatgattgtgcacaatttctttaccaaagcaaatgatgttgaagcagaagat
aggattatagaaatcttaaacagcaatgatacaactgtggcagctatcggaacacctaca
gccagcactttaaaaaattatggggtaaaagtagatattgtaccggaaaaatatcttttt
gaaaatatgcttgctgatatccatgattttatttacggtactcaataa

DBGET integrated database retrieval system