KEGG   Methanohalobium evestigatum: Metev_0422Help
Entry
Metev_0422        CDS       T01261                                 

Definition
(GenBank) CO dehydrogenase/acetyl-CoA synthase, delta subunit
  KO
K00194  acetyl-CoA decarbonylase/synthase, CODH/ACS complex subunit delta [EC:2.1.1.245]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00680  Methane metabolism
mev00720  Carbon fixation pathways in prokaryotes
mev01100  Metabolic pathways
mev01120  Microbial metabolism in diverse environments
mev01200  Carbon metabolism
Module
mev_M00357  Methanogenesis, acetate => methane
mev_M00422  Acetyl-CoA pathway, CO2 => acetyl-CoA
mev_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mev00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metev_0422
   00680 Methane metabolism
    Metev_0422
Enzymes [BR:mev01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.245  5-methyltetrahydrosarcinapterin:corrinoid/iron-sulfur protein Co-methyltransferase
     Metev_0422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdhD His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADI73340
UniProt: D7E7Z8
Position
complement(412267..413595)
Genome map
AA seq 442 aa AA seqDB search
MTKKMKLSDLTEMLKDLDVEALEGVNIEGDIEFDVSGVGLDPNLSYALGYEAAQVSFHIA
NIAKLLGYPVDQLFGASMGAVGQEAPSAEGIAAKTGFSELASSSFEVSPVKEWTHTIEEV
TLGATSSDGGSRGNTITLGGENALPYYFDAEMPHRNYVTMDVFDLPISMAKSVRTNYEDV
MDDPAEWAKKVVNEYNADMVTIHLVSTDPNIEDTSAKEASKVVEDVLQAVDVPLVIGGSG
NPDKDPEVLEKAAEVAEGERALLASASLNLDYERIAKAATDYGHAILSWTQLEINAQKEL
NRKLMTQCNVPRDSILMDPTTAALGYGLDYAYTNMERIRLAGLTGDDELTFPMSSGTTNA
WGARESWMKESPIQNDSDWGPREYRGPIWEISTGLALALAGNDLFMMMHPTSVQVLKETT
QSLFGTKEAEDIDISNWIGAEV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaatgaaattatcagaccttactgagatgttaaaggaccttgatgtggaa
gcacttgaaggtgttaacatcgaaggtgatatagaattcgatgttagtggtgtaggtctt
gatcccaatctatcctatgcgttgggatatgaagcagcacaggtttcatttcatatagca
aacattgcaaaattgttgggatatccggtagaccaactatttggtgcgtcgatgggtgct
gtaggacaggaagcaccatctgctgagggaattgctgcaaaaacaggattttccgaactt
gcttcatccagttttgaagtatccccagtaaaagaatggacacatacaatagaagaagta
actttaggtgcaacatcctctgatggaggttcacgcggtaataccataacacttggtgga
gagaatgcacttccatactattttgatgcagaaatgcctcacagaaattatgtcacaatg
gatgtttttgacctgcctataagtatggcaaaatccgtaagaacaaattatgaagatgtt
atggatgaccctgcggaatgggcaaagaaagtagtaaatgaatataacgctgatatggta
accatacatctggtatcaacagaccccaacatagaagatacatcagcaaaagaagcatca
aaggttgtagaggatgttttgcaggctgttgatgtgcctctggttataggtggttctggt
aatcctgacaaagaccctgaagttcttgaaaaggctgcagaagttgcagagggcgaaagg
gctctgcttgcgtctgcaagcctaaatcttgattatgaacgcattgctaaagcagcaacc
gattacggacacgctattctctcatggacccaacttgaaatcaacgctcaaaaagaactt
aacaggaaactcatgacccagtgcaatgttccaagagacagcatccttatggacccgaca
acagcagcacttggttacggtctggattatgcctataccaatatggaaaggataaggctt
gccggactaacaggtgatgatgaactcacgttccctatgtcatcaggaacaaccaacgca
tggggtgcacgtgaatcatggatgaaagaatcaccaatacaaaatgattcagactgggga
ccaagagagtacagaggacctatatgggaaatatcaaccggtcttgcactggctcttgcc
ggtaacgacctgttcatgatgatgcatccaacatcagtacaggtattgaaagaaacaacc
cagtcgctctttggaacaaaggaagctgaggatatagacatcagtaactggataggggcg
gaggtgtaa

DBGET integrated database retrieval system