KEGG   Methanohalobium evestigatum: Metev_0729Help
Entry
Metev_0729        CDS       T01261                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00260  Glycine, serine and threonine metabolism
mev00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01130  Biosynthesis of antibiotics
mev01230  Biosynthesis of amino acids
Module
mev_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_0729
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0729
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metev_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP SF3A3
Motif
Other DBs
NCBI-ProteinID: ADI73630
UniProt: D7E706
Position
696011..697207
Genome map
AA seq 398 aa AA seqDB search
MTSKATYGKYGGQYVSEMLLPAISELERKYEYYKNNPDFLKDLHYYLNDFAGRETPLYFA
RNLSEKYGIKIYLKREDLLHGGAHKINNTLGQALLARYMGKHRIVAETGAGQHGTATAMA
GAALGLDTVVYMGEKDVERQKTNVYRMEMLGAKVHPVSAGSKTLKDAINEALRDWVSNVD
STHYLIGSVVGPHPYPMIVRDFQCVIGNEVKKQIIEKEGKYPDSIVACTGGGSNAMGTFH
PFVDDTGVKLISVEAGGESMKSTSKAALHSASLCVGEEGILHGAKTRILQDKYGQILESH
SISAGLDYSGVGPELSYLKDSERLNTAVASDKEAIDAFHELCHLEGIIPALESSHAIAHV
LKKAKTGELGNIVVINLSGRGDKDLDTVIKSSKGEGNI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtaaagctacatatggaaaatacggcgggcagtacgtttccgaaatgctgtta
cccgctatatcagaacttgaaagaaaatatgagtattataaaaacaaccctgattttttg
aaggacttgcattactaccttaatgattttgcaggtcgtgagaccccgctttattttgcc
agaaacttaagcgaaaaatacggaataaaaatctatctcaaacgtgaagatctgctacat
ggtggcgctcataaaataaacaatacacttggacaggcactgcttgcaagatacatggga
aaacaccgcatagtagctgaaaccggtgcaggccaacacggcacagcaactgccatggcg
ggagctgcattagggcttgacacagtagtatatatgggagaaaaggatgtggaaaggcaa
aaaacgaatgtctacaggatggaaatgctgggtgcaaaagtacatcctgttagtgccggg
tctaaaaccctgaaagatgctattaatgaggctctcagggattgggtgagtaatgtcgat
agcactcactaccttatcgggtcggtagttggtccccatccgtaccccatgattgtcagg
gatttccagtgtgtaatcggtaatgaagtaaaaaaacaaataatagaaaaagaaggaaaa
tatcccgattcaattgtcgcctgtaccggaggcggaagcaacgcaatgggtacattccac
ccatttgtcgatgatacaggtgtaaaactcatatctgttgaagccggtggagaaagtatg
aaatccacaagtaaagcggctcttcattccgcatcactatgtgttggtgaagaaggaatt
ttacacggtgctaaaacccggatattacaggacaaatacggacagatactggaatctcat
tctatttctgcaggtctggattattcaggagtgggtcctgaactttcttacttgaaagat
tcagaaaggcttaacactgctgttgccagtgataaagaagcaatcgatgctttccacgaa
ttgtgtcatctggaaggaattattcctgcccttgaatcatcccatgccattgctcatgta
ctgaaaaaagcaaaaacaggtgaactgggaaacatagtggtaatcaatctgtcaggcaga
ggagataaagaccttgacactgtaatcaaaagcagtaaaggagaaggaaatatatga

DBGET integrated database retrieval system