KEGG   Methanohalobium evestigatum: Metev_1803Help
Entry
Metev_1803        CDS       T01261                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mev  Methanohalobium evestigatum
Brite
Enzymes [BR:mev01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Metev_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 GCD14 Ubie_methyltran Methyltransf_25 Methyltr_RsmB-F RrnaAD Fibrillarin Methyltransf_3 Methyltransf_11 Methyltransf_32 MTS Met_10 Methyltransf_24 CMAS Methyltransf_23 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ADI74639
UniProt: D7EBC2
Position
complement(1815160..1815810)
Genome map
AA seq 216 aa AA seqDB search
MEYKEERLRLINSLKYQGLSQEILDAMYRVPRHLFVPSESQIDAYVDAPIMIGQNQTISA
PHMVAMMCDLLDLSEGQVVLEVGAGSGYHAAVISELVGESGHVYSIECIEELVNFSRNNL
KNAGYSNVTVIHGDGSEGYPEYAPYDRILVTAGAPDVPDSLLNHLKPEGILVIPVGFYFQ
DLYQIKKELDGSISKNEKGGVMFVPLIGKYGFNMKS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggagtataaagaggagaggttaaggcttataaattctcttaaatatcagggtctgagc
caggaaatactggatgctatgtatcgtgtcccgagacacctttttgttccatcggaatcc
caaatagatgcttatgtggatgcccctataatgatagggcaaaatcaaacgatttctgct
cctcatatggtagcaatgatgtgtgatttacttgatttaagtgagggtcaggttgtcctt
gaagtgggagctggttctggttaccatgcagctgtaatatcagaacttgtaggtgaatca
ggacatgtatattcgatagaatgcatcgaggaactggttaatttttccagaaacaatctt
aaaaatgccggatacagtaatgtgacggtaatccatggtgatggttctgaaggatatccg
gaatatgcaccctatgaccggatacttgtaacagcaggagcaccagatgttcctgacagt
ttattgaaccacttaaagcctgaagggatactggttataccggtgggtttctatttccag
gacctctatcagataaaaaaggaactggacgggtctatcagtaaaaatgaaaagggtggt
gtaatgtttgttccactcatcgggaaatacggttttaacatgaagtcgtga

DBGET integrated database retrieval system