KEGG   Methanobacterium paludis: MSWAN_1543Help
Entry
MSWAN_1543        CDS       T01509                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mew  Methanobacterium paludis
Brite
KEGG Orthology (KO) [BR:mew00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MSWAN_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RP853
Motif
Other DBs
NCBI-ProteinID: AEG18557
UniProt: F6D8C3
Position
1659879..1660859
Genome map
AA seq 326 aa AA seqDB search
MELLLVLGIVTAIYMAFNIAANDIGNSMGTVVGSGALKMRKALLIGALFEFLGAMFLGSN
VIKTVGSGIVPPEFMTSLGAFIITLSAGIWITITLIKKIPISGSDAIVSSVLGYGIAYAG
LNHLNLLTAGYIALSWVVSPLIGLASGFGVYYILKKGLLTKTRKLAYKDRLEKVFSYLQI
GSSSLAALSVGAIDIAAATGVLYVTVGTTAGFDIKFLGALGLVFGILIAGNRITDTIGRR
ITELVPTRGFSAQVSAGTITLIFASLGMPISPTQTLVGSVIGVGMAHGTSTVKLDVIKHI
ATTWIVTIPACVAISATLYFVISYLF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaacttctattggtattgggtattgtaacagccatttacatggctttcaatattgct
gcaaacgacattggaaactccatgggaactgttgtcggaagtggagctcttaaaatgagg
aaagctcttttaattggggctttatttgaatttttaggggctatgttccttggaagtaac
gttataaagacggttggaagcggcattgtgcctcctgagtttatgacaagtctcggggct
tttatcataacgttatctgcaggcatctggatcaccataaccctcataaaaaaaatacca
atatctggctcagatgcaattgtaagttcagttctgggctatggcattgcatacgccggc
cttaatcatttgaaccttcttacagcaggttacatagcattaagctgggtcgtatccccc
ttaataggccttgcatctggttttggagtgtattacatccttaaaaaaggtttattaact
aaaactcgaaaactggcatacaaagacaggttggagaaggttttctcttatcttcaaatt
ggaagttcatcccttgctgcgctaagcgttggtgcaatagatatagcggcagcaaccgga
gtattatacgtaacagttggaacaaccgctggtttcgatattaaatttttaggtgctctg
ggacttgtatttggaattttaattgcaggaaatcggataactgacaccattggtaggcgg
ataactgagctggttccaacaaggggtttttcagcccaggtttcagctggaaccattaca
cttatttttgcatccttgggaatgccaatatctccaacacaaacgcttgtaggctctgta
attggggttggaatggctcacggaacctcaactgttaaacttgacgttattaaacatata
gccaccacatggatcgtgaccattccagcatgtgtggccatttctgcaacactttacttc
gttatttcttatttattttaa

DBGET integrated database retrieval system