KEGG   Methanobacterium paludis: MSWAN_1906Help
Entry
MSWAN_1906        CDS       T01509                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mew  Methanobacterium paludis
Pathway
mew00010  Glycolysis / Gluconeogenesis
mew00020  Citrate cycle (TCA cycle)
mew00620  Pyruvate metabolism
mew00633  Nitrotoluene degradation
mew00640  Propanoate metabolism
mew00650  Butanoate metabolism
mew00680  Methane metabolism
mew00720  Carbon fixation pathways in prokaryotes
mew01100  Metabolic pathways
mew01120  Microbial metabolism in diverse environments
mew01130  Biosynthesis of antibiotics
mew01200  Carbon metabolism
Module
mew_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mew_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_1906
   00020 Citrate cycle (TCA cycle)
    MSWAN_1906
   00620 Pyruvate metabolism
    MSWAN_1906
   00640 Propanoate metabolism
    MSWAN_1906
   00650 Butanoate metabolism
    MSWAN_1906
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_1906
   00680 Methane metabolism
    MSWAN_1906
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MSWAN_1906
Enzymes [BR:mew01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MSWAN_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_2 Fer4_7 Fer4_9 Fer4_21 Fer4_6 Fer4_16 Fer4_10 Fer4_17 Fer4_13 Fer4_3 Fer4_15 Fer4_8 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AEG18915
UniProt: F6D5W2
Position
2003959..2004201
Genome map
AA seq 80 aa AA seqDB search
MVSIGAAVKKPGSTTKNKTGSWRTFKPILDKEKCIECENCVLFCPEGCINKEYDIDYDFC
KGCGICAEECPVKAIKMERE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggtatcaattggagcagctgttaaaaaacctggaagtaccactaaaaataaaacaggt
agctggagaacatttaaaccaattttggacaaggaaaaatgtatagaatgcgaaaattgt
gttcttttctgtccggaaggctgtataaataaagaatatgacatagactacgacttttgt
aaagggtgcggcatatgcgccgaagaatgccctgtaaaagctataaaaatggagagggaa
taa

DBGET integrated database retrieval system