KEGG   Methanobacterium paludis: MSWAN_2054Help
Entry
MSWAN_2054        CDS       T01509                                 

Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mew  Methanobacterium paludis
Pathway
mew00680  Methane metabolism
mew01100  Metabolic pathways
mew01120  Microbial metabolism in diverse environments
mew01200  Carbon metabolism
Module
mew_M00357  Methanogenesis, acetate => methane
mew_M00567  Methanogenesis, CO2 => methane
mew_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mew00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSWAN_2054
Enzymes [BR:mew01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSWAN_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD VMA21
Motif
Other DBs
NCBI-ProteinID: AEG19063
UniProt: F6D2D1
Position
complement(2153430..2154137)
Genome map
AA seq 235 aa AA seqDB search
MDPLLLIGAITAGGVLIGGGVHFIPVGGAPAAIATATGVGTGTAMLAAGSGMTGLITAAA
MTGSPLWVILAAGAVGSMIMLDITMLVGNFIYVWGVGIVPASAKVEYDPITKYPQEKYVT
PGTEGHGIPTVCFVSGTIGAALGGIGGGLVYWALYNALTTAGLSYTSLAATTVAGIFAVG
MFFVNAVIASYNIGGTIEGFHDPKFKRLGRGVLACLLASLVVGIFSVLLIKGGVF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggatccattattattaatcggtgctataaccgctggaggagttcttattggtggaggt
gtacacttcataccggtaggtggtgccccagcagctatagcaacagctacaggtgtcgga
acaggtacagctatgcttgcagcaggttccggtatgactggactcataacagcagcagca
atgacaggatcacctttatgggttatccttgcagcaggtgctgtgggttcaatgatcatg
ctcgacataaccatgctagtaggtaacttcatatacgtatggggtgtaggaattgtacct
gcatcagcaaaagttgaatacgacccaataacaaaatatccgcaagaaaaatatgtaaca
ccaggtactgaaggtcacggaattccaaccgtatgtttcgtaagtggaacaatcggagct
gcccttggtggaattggtggaggattagtttactgggctttatacaatgcattgaccaca
gcaggcttatcatacacttcacttgctgccacaacagtagcaggaatattcgctgttggt
atgttctttgtgaacgcagttattgcatcttacaatataggtggtacaatagaaggattc
cacgaccctaaatttaagagattaggacgtggagtattagcatgtctacttgcatctctt
gtagtaggtattttttcagtacttctaattaaaggaggtgtcttctga

DBGET integrated database retrieval system