KEGG   Methylobacterium extorquens PA1: Mext_0176Help
Entry
Mext_0176         CDS       T00640                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00260  Glycine, serine and threonine metabolism
mex00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01130  Biosynthesis of antibiotics
mex01230  Biosynthesis of amino acids
Module
mex_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mext_0176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mext_0176
Enzymes [BR:mex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mext_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABY28602
UniProt: A9VWM7
Position
complement(190109..191401)
Genome map
AA seq 430 aa AA seqDB search
MGLAREATIRFSRRTVPVTLNPAPNSFRTGPDERGRFGIFGGRFVAETLMPLILDLEKAY
ADAKADPSFKADMESYGTHYIGRPSPLYYAERLTEHLRAQAPAGQGAKIFFKREELNHTG
SHKVNNVLGQILLARRMGKPRIIAETGAGQHGVATATLCARFGLKCVVYMGAVDVERQAP
NVFRMKMLGAEVIPVQSGTRTLKDAMNEALRDWVTNVSDTFYCIGTVAGPHPYPAMVRDF
QSVIGIETKQQMLEMEGRLPDSLIACIGGGSNAMGLFHPFLDDRDVEIFGVEAAGHGVQS
GLHAASLTGGRPGVLHGNRTYLLMNEDGQIADAHSISAGLDYPGIGPEHAWLHEMGRVTY
LSATDAETLEAFKLCSMLEGIIPALEPAHALSKVMELAPTKPAEHLMVLNLSGRGDKDIP
QVAQIFGQTL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggtctagcacgcgaggcaacgatcagattttcgcgaaggaccgtccccgtgacgctg
aaccccgctcccaattccttccgcaccgggccggatgagcgcggtcgcttcggcatcttc
ggcggccgcttcgtggccgagacgctgatgccgctgattctcgatctcgagaaggcctac
gccgacgccaaggccgacccgtcgttcaaggcggatatggaatcctacggcacccactac
atcggccggccgagcccgctctactatgccgagcgcctgaccgagcacctgcgcgcccag
gctccggcggggcagggggcgaagatcttcttcaagcgcgaggagctgaatcacaccggc
tcgcacaaggtgaacaacgtcctcggccagatcctgctcgcccgccgcatgggcaagccg
cggatcatcgccgagaccggcgcaggccagcacggtgtcgcaacggcgacgctgtgcgcc
cgcttcggcctgaaatgcgtggtctacatgggcgccgtcgatgtcgagcggcaggccccg
aacgtgttccgcatgaagatgctcggcgccgaggtgatcccggtgcaatccggcacgcgc
acgctcaaggacgcgatgaacgaggccctgcgcgactgggtcaccaacgtctccgacacc
ttctactgcatcggcaccgtggccggcccccatccctatccggcgatggtgcgcgatttc
caatcggtgatcggcatcgagacgaagcagcagatgctggagatggagggccgcctgccg
gactcgctcatcgcctgcatcggcggcggctcgaacgccatgggcttgttccaccccttc
ctcgatgaccgcgacgtcgaaatcttcggcgtcgaggcagccgggcacggcgtgcagagc
ggcctccacgccgcctcgctcacgggtggccgcccgggcgtgctgcacggcaaccggacc
tacctgctgatgaacgaggacggccagatcgccgacgcccactcgatctcagcgggcctc
gattatcccgggatcggccccgaacacgcatggctgcacgagatgggccgggtcacctac
ctgtcggcgaccgatgcggagacgctggaggcgttcaagctctgctcgatgctggaaggc
atcatcccggctctggagcccgcgcacgcgctgtcgaaggtgatggaactggcgccgacc
aagccggcggagcacctgatggtgctgaacctctccggccgcggcgacaaggacatcccg
caggtggcgcagatcttcggtcagacgctctga

DBGET integrated database retrieval system