KEGG   Methylobacterium extorquens PA1: Mext_0316Help
Entry
Mext_0316         CDS       T00640                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00480  Glutathione metabolism
mex00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mext_0316
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mext_0316
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mext_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABY28740
UniProt: A9VZI4
Position
354142..354696
Genome map
AA seq 184 aa AA seqDB search
MTIRRRDCLAMLAVLAASRAHAAEAGPASAFAFDKPEGGGLPLSAYAGKPILVVNTATAC
GYAPQFVGLQGLWTRFGGRGLTVIAVPSPDFGNQEPLDGAAIADAARKNHGVTFPVTDKT
HVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDGTLRAAFATQVDPSDPRIVSAIVAE
LGQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcgccgccgcgactgccttgcgatgctcgccgttctcgccgcgagccgcgcc
catgccgcggaagccgggccggcgagcgccttcgcctttgacaagccggagggcggcggc
cttccgctctcggcctatgccggcaaacccatcctcgtggtcaacactgccacggcctgc
ggctacgctccgcaattcgtcggccttcaaggtctctggacccgcttcggcgggcgcggc
ctgacggtgattgcggtgccctcgcccgatttcggcaatcaggagccgctcgacggcgcc
gccatcgccgatgccgcgcgaaagaaccacggcgtcaccttcccggtcacggacaagacc
catgtgcgggggccggccgcccatccgttctaccgctgggcggcggagcagaagccgggg
cagagcccgcaatggaacttccacaagtatctcgtcggccgtgacggcaccctgcgtgcg
gccttcgcgacccaagtcgatccgagcgatccgcgcatcgtcagcgccatcgtcgcggaa
ctggggcaggcctga

DBGET integrated database retrieval system