KEGG   Methylobacterium extorquens PA1: Mext_1322Help
Entry
Mext_1322         CDS       T00640                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00010  Glycolysis / Gluconeogenesis
mex00260  Glycine, serine and threonine metabolism
mex00680  Methane metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
mex01230  Biosynthesis of amino acids
Module
mex_M00002  Glycolysis, core module involving three-carbon compounds
mex_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_1322
  Energy metabolism
   00680 Methane metabolism
    Mext_1322
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mext_1322
Enzymes [BR:mex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mext_1322
Membrane trafficking [BR:mex04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mext_1322
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mext_1322
  Exosomal proteins of melanoma cells
   Mext_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABY29723
UniProt: A9W2B7
Position
complement(1467633..1468271)
Genome map
AA seq 212 aa AA seqDB search
MDSTTHTLVLVRHGQSEDNERELFSGLRDPALTARGVNEARAAGRRLKTLGYRFDHAFTS
RLQRAQHTLALILDELSQTDLPVHADAALNERDYGALAGLNKTEARARFGVEQVRSWRKS
SDAVPPGGESLAMTAARLWPFFERAIAPRVRSGECVLVVAHGNSLRSLLMQLDQVAPADI
EDVNIGTAEMLIYRSNTDDQTLVRAAAIACSS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaccacacatactctcgtgctcgtgcggcacggccagagcgaggacaacgag
cgggagctgttttcaggcttgcgagatcctgccctgaccgcgcgcggcgtcaacgaagcg
cgtgccgccggccgcaggctgaagacgctcggatatcgcttcgaccacgcgttcacgagc
cggctccagcgtgctcagcatacgctcgccctgatccttgatgaactgagccaaaccgac
ctgcccgtgcatgcggacgcggccttgaatgaacgagactacggcgcgcttgccggcttg
aacaagacggaggctcgtgcccggttcggcgtcgagcaggtccgctcctggcggaaatct
tccgacgcggtgccgcccggcggcgagagcttggccatgacggcagcgcgcctgtggccg
ttcttcgagcgtgccatcgcacctcgcgttcgaagtggcgaatgcgtgctcgtcgtagct
cacggaaactcgctacgatccctgctcatgcaactcgatcaagtcgcccccgcagacatc
gaagatgtcaacattggtacagcggagatgctcatctaccgcagcaacacagatgatcaa
acgctcgtccgggccgctgcgatcgcttgttcgagctag

DBGET integrated database retrieval system